DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17272 and Tnnc2

DIOPT Version :9

Sequence 1:NP_650917.1 Gene:CG17272 / 42465 FlyBaseID:FBgn0038830 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_001032428.1 Gene:Tnnc2 / 296369 RGDID:1311973 Length:160 Species:Rattus norvegicus


Alignment Length:145 Identity:39/145 - (26%)
Similarity:79/145 - (54%) Gaps:8/145 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YFKEQDIDEFRECFYLF-ARSGQINNLDELTVIMRSLGLSPTIQELVSYLKQ----KNGKMSFAD 63
            |..|:.|.||:..|.:| |..|...::.||..:||.||.:||.:||.:.:::    .:|.:.|.:
  Rat    11 YLSEEMIAEFKAAFDMFDADGGGDISVKELGTVMRMLGQTPTKEELDAIIEEVDEDGSGTIDFEE 75

  Fly    64 FLDIMHQHSKVES---LPDEVIAAFKAADPQNKGTISARQLRNLLQNWGEGLSMREVDNIFREAN 125
            ||.:|.:..|.::   ..:|:...|:..|....|.|.|.:|..:.:..||.::..|::::.::.:
  Rat    76 FLVMMVRQMKEDAKGKSEEELAECFRIFDRNADGYIDAEELAEIFRASGEHVTDEEIESLMKDGD 140

  Fly   126 VNNNSTVRYADFVKI 140
            .||:..:.:.:|:|:
  Rat   141 KNNDGRIDFDEFLKM 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17272NP_650917.1 PTZ00184 1..143 CDD:185504 39/145 (27%)
Tnnc2NP_001032428.1 PTZ00184 12..156 CDD:185504 38/144 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1386217at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.