DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17272 and cam1

DIOPT Version :9

Sequence 1:NP_650917.1 Gene:CG17272 / 42465 FlyBaseID:FBgn0038830 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_593340.1 Gene:cam1 / 2543039 PomBaseID:SPAC3A12.14 Length:150 Species:Schizosaccharomyces pombe


Alignment Length:144 Identity:53/144 - (36%)
Similarity:79/144 - (54%) Gaps:7/144 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RYFKEQDIDEFRECFYLFAR--SGQINNLDELTVIMRSLGLSPTIQELVSYLKQ----KNGKMSF 61
            |...::.|.||||.|.||.|  .|.|.: :||.|:|||||.|||..||...:.:    .||.:.|
pombe     4 RNLTDEQIAEFREAFSLFDRDQDGNITS-NELGVVMRSLGQSPTAAELQDMINEVDADGNGTIDF 67

  Fly    62 ADFLDIMHQHSKVESLPDEVIAAFKAADPQNKGTISARQLRNLLQNWGEGLSMREVDNIFREANV 126
            .:||.:|.:..|.....:||..|||..|....|.|:..:|.::|.:.||.||..||.::.|||:.
pombe    68 TEFLTMMARKMKDTDNEEEVREAFKVFDKDGNGYITVEELTHVLTSLGERLSQEEVADMIREADT 132

  Fly   127 NNNSTVRYADFVKI 140
            :.:..:.|.:|.::
pombe   133 DGDGVINYEEFSRV 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17272NP_650917.1 PTZ00184 1..143 CDD:185504 53/144 (37%)
cam1NP_593340.1 PTZ00184 5..150 CDD:185504 52/143 (36%)
EFh 13..75 CDD:238008 28/62 (45%)
EFh 86..148 CDD:238008 21/61 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23050
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.