DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17272 and CG30378

DIOPT Version :9

Sequence 1:NP_650917.1 Gene:CG17272 / 42465 FlyBaseID:FBgn0038830 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_724628.1 Gene:CG30378 / 246577 FlyBaseID:FBgn0050378 Length:148 Species:Drosophila melanogaster


Alignment Length:144 Identity:38/144 - (26%)
Similarity:75/144 - (52%) Gaps:7/144 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MARYFKEQDIDEFRECFYLF--ARSGQINNLDELTVIMRSLGLSPTIQELVSYLKQKN----GKM 59
            |:....|..|:|.||.|.|:  .|||.: ::.:|..:||:||.|.|..|:.....:.|    |::
  Fly     1 MSGSLTEAQIEEIREAFSLYDKERSGWV-SVQQLGGVMRALGESLTEAEIYDLANESNADFGGQV 64

  Fly    60 SFADFLDIMHQHSKVESLPDEVIAAFKAADPQNKGTISARQLRNLLQNWGEGLSMREVDNIFREA 124
            .|.|||.:|.:..:.::....:..|||..|.....:.:..::|.::.|.||.:|..::..:|::.
  Fly    65 QFKDFLYVMSKRLEEQNSLVCLKQAFKIFDRSEVNSFTINEIRMVMTNLGEKMSEEDLRELFQDI 129

  Fly   125 NVNNNSTVRYADFV 138
            :.:.:..:.:.:||
  Fly   130 DQDKDGKISFNEFV 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17272NP_650917.1 PTZ00184 1..143 CDD:185504 38/144 (26%)
CG30378NP_724628.1 PTZ00184 1..148 CDD:185504 38/144 (26%)
EFh 12..74 CDD:238008 22/62 (35%)
EFh 86..147 CDD:238008 12/58 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443637
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23050
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.