DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17272 and T09B4.4

DIOPT Version :9

Sequence 1:NP_650917.1 Gene:CG17272 / 42465 FlyBaseID:FBgn0038830 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_491778.2 Gene:T09B4.4 / 188316 WormBaseID:WBGene00020378 Length:142 Species:Caenorhabditis elegans


Alignment Length:128 Identity:42/128 - (32%)
Similarity:64/128 - (50%) Gaps:1/128 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MARYFKEQDIDEFRECFYLFARSGQINNLDELTVIMRSLGLSPTIQELVSYLKQKNGK-MSFADF 64
            |..:|.::.|||.||||..::.||.:....:|...:||||.|||..:...|.|:.|.| :.||.|
 Worm     1 MTEFFSQKQIDEIRECFNFYSTSGVLRTDSQLRCALRSLGYSPTASKTDIYFKKLNKKPIEFATF 65

  Fly    65 LDIMHQHSKVESLPDEVIAAFKAADPQNKGTISARQLRNLLQNWGEGLSMREVDNIFREANVN 127
            |||........:...|:|.|....|......:.:|:|..:|.:.||.:|..|:..:..:..||
 Worm    66 LDICKDEQNSPNPLTEIIKALSGLDRNKTRAMPSRELAAILSHVGEQMSPEEIKYLLSKVEVN 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17272NP_650917.1 PTZ00184 1..143 CDD:185504 42/128 (33%)
T09B4.4NP_491778.2 PTZ00183 5..129 CDD:185503 41/124 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 56 1.000 Domainoid score I7317
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S993
OMA 1 1.010 - - QHG52505
OrthoDB 1 1.010 - - D1386217at2759
OrthoFinder 1 1.000 - - FOG0006063
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23050
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.980

Return to query results.
Submit another query.