DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17272 and cal-1

DIOPT Version :9

Sequence 1:NP_650917.1 Gene:CG17272 / 42465 FlyBaseID:FBgn0038830 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_001256428.1 Gene:cal-1 / 179715 WormBaseID:WBGene00000285 Length:180 Species:Caenorhabditis elegans


Alignment Length:138 Identity:45/138 - (32%)
Similarity:78/138 - (56%) Gaps:6/138 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 QDIDEFRECFYLFARSGQ-INNLDELTVIMRSLGLSPTIQELVSYLKQ----KNGKMSFADFLDI 67
            ::||||||.|.:|.:.|. ..:..||.:.|||||.:||.||::..:.:    .||::.|.:|..:
 Worm    40 EEIDEFREAFMMFDKDGNGTISTKELGIAMRSLGQNPTEQEILEMINEVDIDGNGQIEFPEFCVM 104

  Fly    68 MHQHSKVESLPDEVIAAFKAADPQNKGTISARQLRNLLQNWGEGLSMREVDNIFREANVNNNSTV 132
            |.:..| |:..:.:..||:..|....|.|:|::.|..:.:.|...|..|||.:.:|.:|:.:..:
 Worm   105 MKRMMK-ETDSEMIREAFRVFDKDGNGVITAQEFRYFMVHMGMQFSEEEVDEMIKEVDVDGDGEI 168

  Fly   133 RYADFVKI 140
            .|.:|||:
 Worm   169 DYEEFVKM 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17272NP_650917.1 PTZ00184 1..143 CDD:185504 45/138 (33%)
cal-1NP_001256428.1 EFh_PEF 36..177 CDD:330173 45/138 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160157749
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1386217at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23050
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.