DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17272 and Cetn3

DIOPT Version :10

Sequence 1:NP_650917.1 Gene:CG17272 / 42465 FlyBaseID:FBgn0038830 Length:149 Species:Drosophila melanogaster
Sequence 2:XP_063137284.1 Gene:Cetn3 / 170895 RGDID:620249 Length:200 Species:Rattus norvegicus


Alignment Length:139 Identity:38/139 - (27%)
Similarity:67/139 - (48%) Gaps:9/139 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RYFKEQDIDEFRECFYLF-ARSGQINNLDELTVIMRSLGL----SPTIQELVSYLKQKNGKMSFA 62
            |...|:...|.::.|.|| ....|..:..||.|.||:||.    :..::.|..|.::..||::|.
  Rat    43 RELSEEQKQEIKDAFELFDTDKDQAIDYHELKVAMRALGFDVKKADVLKILKDYDREATGKITFE 107

  Fly    63 DFLDIMHQHSKVESLPDEVIAAFKAADPQNKGTISARQLRNLLQNWGEGLSMRE----VDNIFRE 123
            ||.:::..........:|::.|||..|..:.|.||.|.||.:.:..||.:|..|    ::...::
  Rat   108 DFNEVVTDWILERDPHEEILKAFKLFDDDDSGKISLRNLRRVARELGENMSDEELRAMIEEFDKD 172

  Fly   124 ANVNNNSTV 132
            .:..|.:|:
  Rat   173 GDGENEATL 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17272NP_650917.1 PTZ00184 1..143 CDD:185504 38/139 (27%)
Cetn3XP_063137284.1 None

Return to query results.
Submit another query.