DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17272 and CALML6

DIOPT Version :9

Sequence 1:NP_650917.1 Gene:CG17272 / 42465 FlyBaseID:FBgn0038830 Length:149 Species:Drosophila melanogaster
Sequence 2:XP_005244786.2 Gene:CALML6 / 163688 HGNCID:24193 Length:203 Species:Homo sapiens


Alignment Length:145 Identity:44/145 - (30%)
Similarity:72/145 - (49%) Gaps:8/145 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MARYFKEQDIDEFRECFYLFAR--SGQINNLDELTVIMRSLGLSPTIQELVSYLK----QKNGKM 59
            |......:.|.|::..|.:|..  :|::.. .||..:|..||::||..||.|..|    ...|..
Human    48 MTERLSAEQIKEYKGVFEMFDEEGNGEVKT-GELEWLMSLLGINPTKSELASMAKDVDRDNKGFF 111

  Fly    60 SFADFLDIMH-QHSKVESLPDEVIAAFKAADPQNKGTISARQLRNLLQNWGEGLSMREVDNIFRE 123
            :...||.:|. .|.|.::...|:.|||:..|.:.||.|....|:.:|.|.||.|:..|.:.:.:|
Human   112 NCDGFLALMGVYHEKAQNQESELRAAFRVFDKEGKGYIDWNTLKYVLMNAGEPLNEVEAEQMMKE 176

  Fly   124 ANVNNNSTVRYADFV 138
            |:.:.:.|:.|.:||
Human   177 ADKDGDRTIDYEEFV 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17272NP_650917.1 PTZ00184 1..143 CDD:185504 44/145 (30%)
CALML6XP_005244786.2 PTZ00184 48..195 CDD:185504 44/145 (30%)
EFh 59..120 CDD:238008 18/61 (30%)
EFh 133..195 CDD:238008 21/59 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23050
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.