DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17272 and MYL12A

DIOPT Version :10

Sequence 1:NP_650917.1 Gene:CG17272 / 42465 FlyBaseID:FBgn0038830 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_001289978.1 Gene:MYL12A / 10627 HGNCID:16701 Length:177 Species:Homo sapiens


Alignment Length:101 Identity:21/101 - (20%)
Similarity:34/101 - (33%) Gaps:36/101 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 SKNHASLSLSDILPTHQK---------TYDKNRAPKLLGQP----------TVVYFHVTVLS--- 52
            :|:|:..:..|||..|..         .|.:....||.|..          :::..||..||   
Human   249 NKSHSESAKQDILYLHNSLEEVNSTVVEYQRQNDLKLKGMSETLSNLTQRLSLIESHVVALSKAE 313

  Fly    53 -------------IDSINEESM-TYVADIFLAQSWR 74
                         ..::..||: |..:|...|||.:
Human   314 QRTNVSSSTMENRAATLKRESLVTNRSDTVQAQSMK 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17272NP_650917.1 PTZ00184 1..143 CDD:185504 21/101 (21%)
MYL12ANP_001289978.1 PTZ00184 30..168 CDD:185504
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.