DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17272 and cabp7

DIOPT Version :10

Sequence 1:NP_650917.1 Gene:CG17272 / 42465 FlyBaseID:FBgn0038830 Length:149 Species:Drosophila melanogaster
Sequence 2:XP_002934336.2 Gene:cabp7 / 100497989 XenbaseID:XB-GENE-951867 Length:215 Species:Xenopus tropicalis


Alignment Length:136 Identity:41/136 - (30%)
Similarity:65/136 - (47%) Gaps:14/136 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 EQDIDEFRECFYLFARSGQ-INNLDELTVIMRSLGLSPTIQELVSYLKQ----KNGKMSFADFLD 66
            |.:|:|.||.|.:|.|.|. ..:..||...|||||..|...||...:::    .:|::.|.:|:.
 Frog    32 EDEIEEIREAFKVFDRDGNGFISKQELGTAMRSLGYMPNEVELEVIIQRLDMDGDGQVDFEEFVT 96

  Fly    67 IMHQHSKVESLPDEVIAA-----FKAADPQNKGTISARQLRNLL-QNWGEGLSMREVDNIFREAN 125
            ::........:||:...|     |...|.|   ::|..:|:.|| ..:.|.||||:::||.....
 Frog    97 LLGPKITTSGIPDKFHGADFDTVFWKCDMQ---SLSVEELKRLLYDTFCEHLSMRDIENIILTEE 158

  Fly   126 VNNNST 131
            ..|..|
 Frog   159 AGNLGT 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17272NP_650917.1 PTZ00184 1..143 CDD:185504 41/136 (30%)
cabp7XP_002934336.2 PTZ00184 26..154 CDD:185504 38/124 (31%)

Return to query results.
Submit another query.