DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17272 and calml4b

DIOPT Version :9

Sequence 1:NP_650917.1 Gene:CG17272 / 42465 FlyBaseID:FBgn0038830 Length:149 Species:Drosophila melanogaster
Sequence 2:XP_021326249.1 Gene:calml4b / 100321746 ZFINID:ZDB-GENE-071009-6 Length:166 Species:Danio rerio


Alignment Length:146 Identity:54/146 - (36%)
Similarity:88/146 - (60%) Gaps:7/146 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MARYFKEQDIDEFRECFYLF--ARSGQINNLDELTVIMRSLGLSPTIQE----LVSYLKQKNGKM 59
            ||::..:..|:|::|||.|:  .|.|::...|.||| |.|||..||:.|    |:|:...|:|::
Zfish     1 MAKFLSQDQINEYKECFSLYDQKRKGKLKVQDLLTV-MSSLGCCPTLPELHRHLLSHKIDKHGEL 64

  Fly    60 SFADFLDIMHQHSKVESLPDEVIAAFKAADPQNKGTISARQLRNLLQNWGEGLSMREVDNIFREA 124
            .|:.||.|||:..:.|:...|::.|.:..|.:.:|.|:|.:||..|.::||.|..:|||.:..||
Zfish    65 DFSTFLSIMHEQIQQENPRAEILQAVRLTDTEKRGFITAAELRARLTHFGEKLRDQEVDELLSEA 129

  Fly   125 NVNNNSTVRYADFVKI 140
            .|.|:..::|.|..:|
Zfish   130 GVANDGQIKYEDCERI 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17272NP_650917.1 PTZ00184 1..143 CDD:185504 54/146 (37%)
calml4bXP_021326249.1 EFh_PEF 1..141 CDD:330173 52/140 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573241
Domainoid 1 1.000 55 1.000 Domainoid score I11146
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006063
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23050
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.940

Return to query results.
Submit another query.