DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17272 and tnnc2.1

DIOPT Version :9

Sequence 1:NP_650917.1 Gene:CG17272 / 42465 FlyBaseID:FBgn0038830 Length:149 Species:Drosophila melanogaster
Sequence 2:XP_001339131.1 Gene:tnnc2.1 / 100002038 ZFINID:ZDB-GENE-090312-215 Length:161 Species:Danio rerio


Alignment Length:145 Identity:36/145 - (24%)
Similarity:74/145 - (51%) Gaps:8/145 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YFKEQDIDEFRECFYLFARSGQIN-NLDELTVIMRSLGLSPTIQELVSYLKQ----KNGKMSFAD 63
            :..|:.|.||:..|.:|...|..: :..||..:||.||.:|:.:||.:.:::    .:|.:.|.:
Zfish    12 FLSEEMIAEFKAAFDMFDTDGGGDISTKELGTVMRMLGQNPSREELDAIIEEVDEDGSGTIDFEE 76

  Fly    64 FLDIMHQHSKVESL---PDEVIAAFKAADPQNKGTISARQLRNLLQNWGEGLSMREVDNIFREAN 125
            ||.:|.|..|.:..   .:|:...|:..|....|.|...:..::|...||.::..::|.:..:|:
Zfish    77 FLVMMVQQLKEDQAGKSEEELSECFRIFDKNQDGFIDREEFGDILHATGEPVAEEDIDELMADAD 141

  Fly   126 VNNNSTVRYADFVKI 140
            .|.:..:.:.:|:|:
Zfish   142 TNKDGKIDFDEFLKM 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17272NP_650917.1 PTZ00184 1..143 CDD:185504 36/145 (25%)
tnnc2.1XP_001339131.1 EFh_PEF 13..157 CDD:330173 36/144 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1386217at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.