DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS20 and rpsJ

DIOPT Version :9

Sequence 1:NP_524421.1 Gene:RpS20 / 42464 FlyBaseID:FBgn0019936 Length:120 Species:Drosophila melanogaster
Sequence 2:NP_417780.1 Gene:rpsJ / 947816 ECOCYCID:EG10909 Length:103 Species:Escherichia coli


Alignment Length:99 Identity:27/99 - (27%)
Similarity:57/99 - (57%) Gaps:2/99 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 RIRITLTSRNVRSLENVCRDLINGAKNQNLRVKGPVRMPTKTLRITTRKTPCGEGSKTWDRFQMR 85
            ||||.|.:.:.|.::....:::..||....:|:||:.:||:..|.|...:| .......|::::|
E. coli     5 RIRIRLKAFDHRLIDQATAEIVETAKRTGAQVRGPIPLPTRKERFTVLISP-HVNKDARDQYEIR 68

  Fly    86 IHKRIIDLHSPSE-IVKKITSINIEPGVEVEVTI 118
            .|.|::|:..|:| .|..:..:::..||:|::::
E. coli    69 THLRLVDIVEPTEKTVDALMRLDLAAGVDVQISL 102

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS20NP_524421.1 Ribosomal_S10 6..118 CDD:412302 27/97 (28%)
rpsJNP_417780.1 rpsJ 1..102 CDD:179076 27/97 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 49 1.000 Domainoid score I689
eggNOG 1 0.900 - - E1_COG0051
Hieranoid 00.000 Not matched by this tool.
Inparanoid 1 1.050 52 1.000 Inparanoid score I454
OMA 1 1.010 - - QHG60602
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto111957
orthoMCL 1 0.900 - - OOG6_100367
Panther 1 1.100 - - O PTHR11700
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.