DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS20 and RPS20

DIOPT Version :9

Sequence 1:NP_524421.1 Gene:RpS20 / 42464 FlyBaseID:FBgn0019936 Length:120 Species:Drosophila melanogaster
Sequence 2:NP_011848.1 Gene:RPS20 / 856371 SGDID:S000001007 Length:121 Species:Saccharomyces cerevisiae


Alignment Length:118 Identity:65/118 - (55%)
Similarity:86/118 - (72%) Gaps:4/118 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 DIEKPHVGD----SASVHRIRITLTSRNVRSLENVCRDLINGAKNQNLRVKGPVRMPTKTLRITT 67
            |.:|..|.:    ...:.:|||||||..|:.||||..:::..|:..||..|||||:|||.|:|:|
Yeast     3 DFQKEKVEEQEQQQQQIIKIRITLTSTKVKQLENVSSNIVKNAEQHNLVKKGPVRLPTKVLKIST 67

  Fly    68 RKTPCGEGSKTWDRFQMRIHKRIIDLHSPSEIVKKITSINIEPGVEVEVTIAN 120
            ||||.|||||||:.::||||||.|||.:|.:|||:||.|.|||||:|||.:|:
Yeast    68 RKTPNGEGSKTWETYEMRIHKRYIDLEAPVQIVKRITQITIEPGVDVEVVVAS 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS20NP_524421.1 Ribosomal_S10 6..118 CDD:412302 64/114 (56%)
RPS20NP_011848.1 Ribosomal_S10 23..118 CDD:412302 60/94 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344460
Domainoid 1 1.000 126 1.000 Domainoid score I1183
eggNOG 1 0.900 - - E1_COG0051
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H37417
Inparanoid 1 1.050 132 1.000 Inparanoid score I1235
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG60602
OrthoFinder 1 1.000 - - FOG0001389
OrthoInspector 1 1.000 - - oto100263
orthoMCL 1 0.900 - - OOG6_100367
Panther 1 1.100 - - LDO PTHR11700
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1236
SonicParanoid 1 1.000 - - X970
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.