DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS20 and RSM10

DIOPT Version :10

Sequence 1:NP_524421.1 Gene:RpS20 / 42464 FlyBaseID:FBgn0019936 Length:120 Species:Drosophila melanogaster
Sequence 2:NP_010326.1 Gene:RSM10 / 851611 SGDID:S000002448 Length:203 Species:Saccharomyces cerevisiae


Alignment Length:38 Identity:14/38 - (36%)
Similarity:22/38 - (57%) Gaps:1/38 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 GPVRMPTKTLRITTRKTPCGEGSKTWDRFQMRIHKRII 91
            ||..:||:..|.|..|:|... :|:.:.|:...|||:|
Yeast    75 GPKPLPTRRERWTVIKSPFVH-AKSKENFERHTHKRLI 111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS20NP_524421.1 rpsJ 6..118 CDD:469716 14/38 (37%)
RSM10NP_010326.1 Ribosomal_S10 45..141 CDD:459769 14/38 (37%)

Return to query results.
Submit another query.