DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS20 and AT3G47370

DIOPT Version :9

Sequence 1:NP_524421.1 Gene:RpS20 / 42464 FlyBaseID:FBgn0019936 Length:120 Species:Drosophila melanogaster
Sequence 2:NP_001030826.1 Gene:AT3G47370 / 823891 AraportID:AT3G47370 Length:122 Species:Arabidopsis thaliana


Alignment Length:102 Identity:72/102 - (70%)
Similarity:91/102 - (89%) Gaps:0/102 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 VHRIRITLTSRNVRSLENVCRDLINGAKNQNLRVKGPVRMPTKTLRITTRKTPCGEGSKTWDRFQ 83
            :|:|||||:|:||::||.||.||:.|||::.||||||||||||.|:|||||.|||||:.|||||:
plant    20 IHKIRITLSSKNVKNLEKVCTDLVRGAKDKRLRVKGPVRMPTKVLKITTRKAPCGEGTNTWDRFE 84

  Fly    84 MRIHKRIIDLHSPSEIVKKITSINIEPGVEVEVTIAN 120
            :|:|||:|||.|..::||:||||.||||||||||||:
plant    85 LRVHKRVIDLFSSPDVVKQITSITIEPGVEVEVTIAD 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS20NP_524421.1 Ribosomal_S10 6..118 CDD:412302 69/98 (70%)
AT3G47370NP_001030826.1 Ribosomal_S10 4..119 CDD:412302 69/98 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 150 1.000 Domainoid score I1417
eggNOG 1 0.900 - - E1_COG0051
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H37417
Inparanoid 1 1.050 160 1.000 Inparanoid score I1635
OMA 1 1.010 - - QHG60602
OrthoDB 1 1.010 - - D1454256at2759
OrthoFinder 1 1.000 - - FOG0001389
OrthoInspector 1 1.000 - - otm3285
orthoMCL 1 0.900 - - OOG6_100367
Panther 1 1.100 - - O PTHR11700
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X970
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.