DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS20 and AT3G13120

DIOPT Version :9

Sequence 1:NP_524421.1 Gene:RpS20 / 42464 FlyBaseID:FBgn0019936 Length:120 Species:Drosophila melanogaster
Sequence 2:NP_001189875.1 Gene:AT3G13120 / 820500 AraportID:AT3G13120 Length:191 Species:Arabidopsis thaliana


Alignment Length:127 Identity:36/127 - (28%)
Similarity:68/127 - (53%) Gaps:14/127 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 PKDIEKP--HVGDSASV----------HRIRITLTSRNVRSLENVCRDLINGAKNQNLRVKGPVR 57
            |:.:::|  .|..|:|:          .:|||.|.|..|..:|:.|:.:::.|:|.|.:..|||.
plant    66 PEILDEPASEVPSSSSISVDADKMAPKQKIRIKLRSYWVPLIEDSCKQILDAARNTNAKTMGPVP 130

  Fly    58 MPTKTLRITTRKTPCGEGSKTWDRFQMRIHKRIID-LHSPSEIVKKITSINIEPGVEVEVTI 118
            :|||.......|:|.......: .|::|.|:|:|| |:..::.:..:..:::..||:|||.:
plant   131 LPTKKRIYCVLKSPHVHKDARF-HFEIRTHQRMIDILYPTAQTIDSLMQLDLPAGVDVEVKL 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS20NP_524421.1 Ribosomal_S10 6..118 CDD:412302 35/124 (28%)
AT3G13120NP_001189875.1 rpsJ 92..191 CDD:179076 31/99 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0051
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100367
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.760

Return to query results.
Submit another query.