DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS20 and RPS20

DIOPT Version :10

Sequence 1:NP_524421.1 Gene:RpS20 / 42464 FlyBaseID:FBgn0019936 Length:120 Species:Drosophila melanogaster
Sequence 2:NP_001139699.1 Gene:RPS20 / 6224 HGNCID:10405 Length:142 Species:Homo sapiens


Alignment Length:115 Identity:91/115 - (79%)
Similarity:100/115 - (86%) Gaps:1/115 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KDIEKPHVGDSASVHRIRITLTSRNVRSLENVCRDLINGAKNQNLRVKGPVRMPTKTLRITTRKT 70
            ||..|..|....::||||||||||||:|||.||.|||.|||.:||:|||||||||||||||||||
Human     4 KDTGKTPVEPEVAIHRIRITLTSRNVKSLEKVCADLIRGAKEKNLKVKGPVRMPTKTLRITTRKT 68

  Fly    71 PCGEGSKTWDRFQMRIHKRIIDLHSPSEIVKKITSINIEPGVE-VEVTIA 119
            |||||||||||||||||||:|||||||||||:||||:|||||| :|.|.|
Human    69 PCGEGSKTWDRFQMRIHKRLIDLHSPSEIVKQITSISIEPGVELIESTDA 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS20NP_524421.1 rpsJ 6..118 CDD:469716 89/112 (79%)
RPS20NP_001139699.1 rpsJ 16..112 CDD:469716 83/95 (87%)

Return to query results.
Submit another query.