DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS20 and RPS20

DIOPT Version :9

Sequence 1:NP_524421.1 Gene:RpS20 / 42464 FlyBaseID:FBgn0019936 Length:120 Species:Drosophila melanogaster
Sequence 2:NP_001139699.1 Gene:RPS20 / 6224 HGNCID:10405 Length:142 Species:Homo sapiens


Alignment Length:115 Identity:91/115 - (79%)
Similarity:100/115 - (86%) Gaps:1/115 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KDIEKPHVGDSASVHRIRITLTSRNVRSLENVCRDLINGAKNQNLRVKGPVRMPTKTLRITTRKT 70
            ||..|..|....::||||||||||||:|||.||.|||.|||.:||:|||||||||||||||||||
Human     4 KDTGKTPVEPEVAIHRIRITLTSRNVKSLEKVCADLIRGAKEKNLKVKGPVRMPTKTLRITTRKT 68

  Fly    71 PCGEGSKTWDRFQMRIHKRIIDLHSPSEIVKKITSINIEPGVE-VEVTIA 119
            |||||||||||||||||||:|||||||||||:||||:|||||| :|.|.|
Human    69 PCGEGSKTWDRFQMRIHKRLIDLHSPSEIVKQITSISIEPGVELIESTDA 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS20NP_524421.1 Ribosomal_S10 6..118 CDD:412302 89/112 (79%)
RPS20NP_001139699.1 Ribosomal_S10 16..112 CDD:320896 83/95 (87%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149994
Domainoid 1 1.000 176 1.000 Domainoid score I3629
eggNOG 1 0.900 - - E1_COG0051
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H37417
Inparanoid 1 1.050 191 1.000 Inparanoid score I3879
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG60602
OrthoDB 1 1.010 - - D1454256at2759
OrthoFinder 1 1.000 - - FOG0001389
OrthoInspector 1 1.000 - - oto91511
orthoMCL 1 0.900 - - OOG6_100367
Panther 1 1.100 - - LDO PTHR11700
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1236
SonicParanoid 1 1.000 - - X970
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.