powered by:
Protein Alignment RpS20 and mrps10
DIOPT Version :9
Sequence 1: | NP_524421.1 |
Gene: | RpS20 / 42464 |
FlyBaseID: | FBgn0019936 |
Length: | 120 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001153460.1 |
Gene: | mrps10 / 565937 |
ZFINID: | ZDB-GENE-040914-39 |
Length: | 187 |
Species: | Danio rerio |
Alignment Length: | 41 |
Identity: | 12/41 - (29%) |
Similarity: | 21/41 - (51%) |
Gaps: | 4/41 - (9%) |
- Green bases have known domain annotations that are detailed below.
Fly 81 RFQMRIHKRIIDLH----SPSEIVKKITSINIEPGVEVEVT 117
:::||.|.|.|.:. |.:.:..:....|:..||.:|||
Zfish 122 QYEMRTHYRCIQISRITGSSARVYLEYIQRNLPEGVAMEVT 162
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0051 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.