DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS20 and MRPS10

DIOPT Version :9

Sequence 1:NP_524421.1 Gene:RpS20 / 42464 FlyBaseID:FBgn0019936 Length:120 Species:Drosophila melanogaster
Sequence 2:XP_011513026.1 Gene:MRPS10 / 55173 HGNCID:14502 Length:211 Species:Homo sapiens


Alignment Length:121 Identity:26/121 - (21%)
Similarity:51/121 - (42%) Gaps:10/121 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 PKDIEKP--HVGDSASV--HRIRITLTSRNVRSLENVCRDLINGAKNQNLRVKGPVRMPTKTLRI 65
            |||:.||  .:.|...:  .|:.:.:...:...|::.....:..||...:.:|  |..|.:.:..
Human    65 PKDLTKPVVTISDEPDILYKRLSVLVKGHDKAVLDSYEYFAVLAAKELGISIK--VHEPPRKIER 127

  Fly    66 TTRKTPCGEGSKTWDRFQMRIHKRIIDLH----SPSEIVKKITSINIEPGVEVEVT 117
            .|.........|...:::||...|.::|.    |.:::..:....|:..||.:|||
Human   128 FTLLQSVHIYKKHRVQYEMRTLYRCLELEHLTGSTADVYLEYIQRNLPEGVAMEVT 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS20NP_524421.1 Ribosomal_S10 6..118 CDD:412302 25/120 (21%)
MRPS10XP_011513026.1 Ribosomal_S10 90..182 CDD:278753 16/93 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0051
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.