powered by:
Protein Alignment RpS20 and mRpS10
DIOPT Version :9
Sequence 1: | NP_524421.1 |
Gene: | RpS20 / 42464 |
FlyBaseID: | FBgn0019936 |
Length: | 120 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_524355.2 |
Gene: | mRpS10 / 41838 |
FlyBaseID: | FBgn0038307 |
Length: | 173 |
Species: | Drosophila melanogaster |
Alignment Length: | 37 |
Identity: | 8/37 - (21%) |
Similarity: | 22/37 - (59%) |
Gaps: | 7/37 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 84 MRIHKRIIDLHSP-------SEIVKKITSINIEPGVE 113
|::|.:.:||:|. ::.::.::::|...||:
Fly 1 MKMHMKHLDLYSQAIKTLRWTQPMRALSTVNTSSGVQ 37
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0051 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.