DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS20 and rps-20

DIOPT Version :9

Sequence 1:NP_524421.1 Gene:RpS20 / 42464 FlyBaseID:FBgn0019936 Length:120 Species:Drosophila melanogaster
Sequence 2:NP_740944.1 Gene:rps-20 / 173309 WormBaseID:WBGene00004489 Length:117 Species:Caenorhabditis elegans


Alignment Length:120 Identity:83/120 - (69%)
Similarity:105/120 - (87%) Gaps:3/120 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAAAPKDIEKPHVGDSASVHRIRITLTSRNVRSLENVCRDLINGAKNQNLRVKGPVRMPTKTLRI 65
            ||.|.|: ||. :.|: |.||||:||||:||:.||.||..||:||||::|.||||:|||||.|||
 Worm     1 MAVAFKN-EKA-ITDN-SEHRIRLTLTSQNVKPLEKVCAQLIDGAKNEHLIVKGPIRMPTKVLRI 62

  Fly    66 TTRKTPCGEGSKTWDRFQMRIHKRIIDLHSPSEIVKKITSINIEPGVEVEVTIAN 120
            ||||||||||||||||||||||||:|:||:|:|::::||||:|||||::|||.|:
 Worm    63 TTRKTPCGEGSKTWDRFQMRIHKRLINLHAPAEVLRQITSISIEPGVDIEVTRAD 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS20NP_524421.1 Ribosomal_S10 6..118 CDD:412302 78/111 (70%)
rps-20NP_740944.1 Ribosomal_S10 5..114 CDD:381939 77/111 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160161295
Domainoid 1 1.000 158 1.000 Domainoid score I2517
eggNOG 1 0.900 - - E1_COG0051
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H37417
Inparanoid 1 1.050 166 1.000 Inparanoid score I2800
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG60602
OrthoDB 1 1.010 - - D1454256at2759
OrthoFinder 1 1.000 - - FOG0001389
OrthoInspector 1 1.000 - - oto19271
orthoMCL 1 0.900 - - OOG6_100367
Panther 1 1.100 - - LDO PTHR11700
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1236
SonicParanoid 1 1.000 - - X970
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1514.840

Return to query results.
Submit another query.