DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS20 and AgaP_AGAP010591

DIOPT Version :9

Sequence 1:NP_524421.1 Gene:RpS20 / 42464 FlyBaseID:FBgn0019936 Length:120 Species:Drosophila melanogaster
Sequence 2:XP_314556.3 Gene:AgaP_AGAP010591 / 1275318 VectorBaseID:AGAP010591 Length:121 Species:Anopheles gambiae


Alignment Length:119 Identity:103/119 - (86%)
Similarity:109/119 - (91%) Gaps:1/119 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 AAAPKDIEKPHVGDSASVHRIRITLTSRNVRSLENVCRDLINGAKNQNLRVKGPVRMPTKTLRIT 66
            |.|.|||||| |.::|:|||||||||||||||||.||.|||.|||.|.||||||||||||.||||
Mosquito     3 AVATKDIEKP-VVETATVHRIRITLTSRNVRSLEKVCADLIAGAKKQKLRVKGPVRMPTKILRIT 66

  Fly    67 TRKTPCGEGSKTWDRFQMRIHKRIIDLHSPSEIVKKITSINIEPGVEVEVTIAN 120
            |||||||||||||||||||||||||||||||||||:|||||:|||||||||||:
Mosquito    67 TRKTPCGEGSKTWDRFQMRIHKRIIDLHSPSEIVKQITSINMEPGVEVEVTIAD 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS20NP_524421.1 Ribosomal_S10 6..118 CDD:412302 98/111 (88%)
AgaP_AGAP010591XP_314556.3 Ribosomal_S10 14..118 CDD:412302 91/103 (88%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 176 1.000 Domainoid score I7485
eggNOG 1 0.900 - - E1_COG0051
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H37417
Inparanoid 1 1.050 201 1.000 Inparanoid score I6181
OMA 1 1.010 - - QHG60602
OrthoDB 1 1.010 - - D1454256at2759
OrthoFinder 1 1.000 - - FOG0001389
OrthoInspector 1 1.000 - - oto111068
Panther 1 1.100 - - LDO PTHR11700
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X970
TreeFam 1 0.960 - -
1312.940

Return to query results.
Submit another query.