DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS20 and LOC100909911

DIOPT Version :9

Sequence 1:NP_524421.1 Gene:RpS20 / 42464 FlyBaseID:FBgn0019936 Length:120 Species:Drosophila melanogaster
Sequence 2:XP_038946099.1 Gene:LOC100909911 / 100909911 RGDID:6500917 Length:160 Species:Rattus norvegicus


Alignment Length:119 Identity:94/119 - (78%)
Similarity:103/119 - (86%) Gaps:0/119 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 AAAPKDIEKPHVGDSASVHRIRITLTSRNVRSLENVCRDLINGAKNQNLRVKGPVRMPTKTLRIT 66
            |.|.||..|..|....::|.||||||||||:|||.||.|||.|||.:||:|||||||||||||||
  Rat    41 ATAFKDTGKTPVEPEMAIHPIRITLTSRNVKSLEKVCADLIRGAKEKNLKVKGPVRMPTKTLRIT 105

  Fly    67 TRKTPCGEGSKTWDRFQMRIHKRIIDLHSPSEIVKKITSINIEPGVEVEVTIAN 120
            ||||||.||||||||||||||||:|||||||||||:||||:||||||||||||:
  Rat   106 TRKTPCSEGSKTWDRFQMRIHKRLIDLHSPSEIVKQITSISIEPGVEVEVTIAD 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS20NP_524421.1 Ribosomal_S10 6..118 CDD:412302 89/111 (80%)
LOC100909911XP_038946099.1 PTZ00039 57..157 CDD:173336 85/99 (86%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343906
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.