DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS20 and LOC100364116

DIOPT Version :9

Sequence 1:NP_524421.1 Gene:RpS20 / 42464 FlyBaseID:FBgn0019936 Length:120 Species:Drosophila melanogaster
Sequence 2:XP_038955307.1 Gene:LOC100364116 / 100364116 RGDID:2321641 Length:121 Species:Rattus norvegicus


Alignment Length:119 Identity:93/119 - (78%)
Similarity:104/119 - (87%) Gaps:6/119 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KDIEK----PHVGDSASVHRIRITLTSRNVRSLENVCRDLINGAKNQNLRVKGPVRMPTKTLRIT 66
            ||..|    |.|  :..:||||||||:||::|||.||.|||.|||.:||:|||||||||||||||
  Rat     4 KDTGKTPMEPEV--AIHLHRIRITLTNRNMKSLEKVCADLIRGAKEKNLKVKGPVRMPTKTLRIT 66

  Fly    67 TRKTPCGEGSKTWDRFQMRIHKRIIDLHSPSEIVKKITSINIEPGVEVEVTIAN 120
            |||||||||||||||||||||||:|||||||||||:||||:||||||||||||:
  Rat    67 TRKTPCGEGSKTWDRFQMRIHKRLIDLHSPSEIVKQITSISIEPGVEVEVTIAD 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS20NP_524421.1 Ribosomal_S10 6..118 CDD:412302 90/115 (78%)
LOC100364116XP_038955307.1 Ribosomal_S10 8..118 CDD:412302 88/111 (79%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343908
Domainoid 1 1.000 176 1.000 Domainoid score I3510
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 191 1.000 Inparanoid score I3780
OMA 1 1.010 - - QHG60602
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001389
OrthoInspector 1 1.000 - - otm46304
orthoMCL 1 0.900 - - OOG6_100367
Panther 1 1.100 - - O PTHR11700
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X970
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1211.900

Return to query results.
Submit another query.