DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS20 and LOC100362684

DIOPT Version :9

Sequence 1:NP_524421.1 Gene:RpS20 / 42464 FlyBaseID:FBgn0019936 Length:120 Species:Drosophila melanogaster
Sequence 2:XP_002729620.1 Gene:LOC100362684 / 100362684 RGDID:2324274 Length:119 Species:Rattus norvegicus


Alignment Length:115 Identity:94/115 - (81%)
Similarity:103/115 - (89%) Gaps:0/115 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KDIEKPHVGDSASVHRIRITLTSRNVRSLENVCRDLINGAKNQNLRVKGPVRMPTKTLRITTRKT 70
            ||..|..|....::||||||||||||:|||.||.|||.|||.:||:|||||||||||||||||||
  Rat     4 KDTGKTPVEPEVAIHRIRITLTSRNVKSLEKVCADLIRGAKEKNLKVKGPVRMPTKTLRITTRKT 68

  Fly    71 PCGEGSKTWDRFQMRIHKRIIDLHSPSEIVKKITSINIEPGVEVEVTIAN 120
            |||||||||||||||||||:|||||||||||:||||:||||||||||||:
  Rat    69 PCGEGSKTWDRFQMRIHKRLIDLHSPSEIVKQITSISIEPGVEVEVTIAD 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS20NP_524421.1 Ribosomal_S10 6..118 CDD:412302 91/111 (82%)
LOC100362684XP_002729620.1 Ribosomal_S10 16..116 CDD:412302 87/99 (88%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343910
Domainoid 1 1.000 176 1.000 Domainoid score I3510
eggNOG 1 0.900 - - E1_COG0051
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 191 1.000 Inparanoid score I3780
OMA 1 1.010 - - QHG60602
OrthoDB 1 1.010 - - D1454256at2759
OrthoFinder 1 1.000 - - FOG0001389
OrthoInspector 1 1.000 - - otm46304
orthoMCL 1 0.900 - - OOG6_100367
Panther 1 1.100 - - LDO PTHR11700
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X970
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1413.810

Return to query results.
Submit another query.