DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17271 and Mcfd2

DIOPT Version :10

Sequence 1:NP_650916.1 Gene:CG17271 / 42463 FlyBaseID:FBgn0038829 Length:281 Species:Drosophila melanogaster
Sequence 2:XP_006523963.1 Gene:Mcfd2 / 193813 MGIID:2183439 Length:154 Species:Mus musculus


Alignment Length:132 Identity:57/132 - (43%)
Similarity:78/132 - (59%) Gaps:16/132 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 HQQAGGHHHGQPQQVLNTGNIQQERAHIQEHMQVPID--TSKMSEAELQFHYFKMHDSDNNNKLD 186
            |......|||......:|.:.|:   ||.||::..||  .::||..|||.|||||||.|.|:.||
Mouse    36 HDHGADVHHGSVGLDKSTVHDQE---HIMEHLEGVIDQPEAEMSPQELQLHYFKMHDYDGNSLLD 97

  Fly   187 GCELIKSLIHWH-EQGSKEQPNGEKPHVEEKVFSDEELVALIDPILQMDDTSRDGYIDYPEFIKA 250
            |.||..::.|.| |:||::.|          |.|::|||::||.:|:.||.:.||||||.||.|:
Mouse    98 GLELSIAITHVHKEEGSEQAP----------VMSEDELVSIIDGVLRDDDKNNDGYIDYAEFAKS 152

  Fly   251 QQ 252
            .|
Mouse   153 LQ 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17271NP_650916.1 EF-hand_7 174..250 CDD:463900 36/76 (47%)
Mcfd2XP_006523963.1 EF-hand_7 85..151 CDD:463900 36/75 (48%)

Return to query results.
Submit another query.