DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17270 and ERG28

DIOPT Version :9

Sequence 1:NP_001262785.1 Gene:CG17270 / 42462 FlyBaseID:FBgn0038828 Length:169 Species:Drosophila melanogaster
Sequence 2:NP_563858.1 Gene:ERG28 / 837538 AraportID:AT1G10030 Length:129 Species:Arabidopsis thaliana


Alignment Length:103 Identity:21/103 - (20%)
Similarity:39/103 - (37%) Gaps:10/103 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 WIAFVAFMDLGTAFRSYIERRSF-LGDHSDTQFIEGDYTISRIIGMYCLLKAIALVHCTLYIHYK 84
            |:..|..:.|.:.:..:....:. |...|.|...|   ...|..|::.||.......|...:..|
plant     7 WLMVVGSLRLASVWFGFFNIWALRLAVFSQTTMSE---VHGRTFGVWTLLTCTLCFLCAFNLENK 68

  Fly    85 PVVSMGGCSLALTMVFYATEALYFRS------STINFY 116
            |:......|....:..:.||.|::::      ||:.|:
plant    69 PLYLATFLSFIYALGHFLTEYLFYQTMTIANLSTVGFF 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17270NP_001262785.1 Erg28 16..125 CDD:397654 21/103 (20%)
ERG28NP_563858.1 Erg28 3..97 CDD:397654 18/92 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3455
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1590576at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR15451
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.