DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17270 and erg28

DIOPT Version :9

Sequence 1:NP_001262785.1 Gene:CG17270 / 42462 FlyBaseID:FBgn0038828 Length:169 Species:Drosophila melanogaster
Sequence 2:XP_031746317.1 Gene:erg28 / 549293 XenbaseID:XB-GENE-956432 Length:171 Species:Xenopus tropicalis


Alignment Length:129 Identity:29/129 - (22%)
Similarity:57/129 - (44%) Gaps:18/129 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 RLLYAFRGWIAFVAFMDLGTAFRSYIERRSFLGDHSDTQFIEGDYTIS---------RIIGMYCL 68
            |.|...|.|:..|:.:..|..|:|:.: .|||.|..        ||.|         |..|::.|
 Frog    31 RFLAVLRSWLMMVSIIAAGNTFQSFRD-HSFLSDKL--------YTASPNLVNGLQARTFGVWTL 86

  Fly    69 LKAIALVHCTLYIHYKPVVSMGGCSLALTMVFYATEALYFRSSTINFYVIFPCVLNSITLLGLI 132
            |.::....|.:.|..|.:..:...:..|.:..:..|...::::.|...::.|.::.|.::||::
 Frog    87 LSSVIRCACAVDIRNKTLYHLTLWTFILALGHFLAEVFVYQTAAITIGIMAPLMVASFSILGML 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17270NP_001262785.1 Erg28 16..125 CDD:397654 24/117 (21%)
erg28XP_031746317.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 43 1.000 Inparanoid score I5306
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1590576at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.060

Return to query results.
Submit another query.