DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17270 and erg-28

DIOPT Version :9

Sequence 1:NP_001262785.1 Gene:CG17270 / 42462 FlyBaseID:FBgn0038828 Length:169 Species:Drosophila melanogaster
Sequence 2:NP_506154.1 Gene:erg-28 / 179727 WormBaseID:WBGene00007589 Length:162 Species:Caenorhabditis elegans


Alignment Length:169 Identity:32/169 - (18%)
Similarity:61/169 - (36%) Gaps:59/169 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 RGWIAFVAFMDLGTAFRSYIERRSFLGDHSDTQFIEGDYT-----ISRI----IGMYCLLK---- 70
            |.|::.|....:|:.:..|.::.|  ..|         ||     :||.    :.:.|:|:    
 Worm     6 RAWMSIVVVQAMGSVWMCYAKQNS--ASH---------YTSTLPALSRAHALPLALLCILRIVLI 59

  Fly    71 ------AIALVHCTLYIHYKPVVSMGGCSLALTMVFYATEALYFRSSTINFYVIFPCVLNSITLL 129
                  :|.:.|..|.|              ||.:...||..:::|.:.....:....|||.:::
 Worm    60 FDFRNFSIHIAHILLSI--------------LTAIHTMTEVFFYQSMSYGIVTVTEVTLNSFSVV 110

  Fly   130 GLIYIPKRLRLWEPNMDLDDENSQLLKQMTGFKRRRAKK 168
            .::..     |..|:...:.|.          |.:||:|
 Worm   111 VMLTF-----LLSPSFKNEQEG----------KEKRARK 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17270NP_001262785.1 Erg28 16..125 CDD:397654 23/124 (19%)
erg-28NP_506154.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3455
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.