DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syp and SART3

DIOPT Version :9

Sequence 1:NP_001262777.1 Gene:Syp / 42460 FlyBaseID:FBgn0038826 Length:761 Species:Drosophila melanogaster
Sequence 2:XP_005269298.1 Gene:SART3 / 9733 HGNCID:16860 Length:981 Species:Homo sapiens


Alignment Length:567 Identity:113/567 - (19%)
Similarity:189/567 - (33%) Gaps:200/567 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 PSCSKM---AEGNGELLDDINQKADDRGDGERTEDYPKLLEYGLDKKVAGKLDEIYKTGKLAHAE 99
            |||..|   |.....|.::: |||.:..|...|....|.....|:          |...:.||.:
Human   488 PSCVIMQNWARIEARLCNNM-QKARELWDSIMTRGNAKYANMWLE----------YYNLERAHGD 541

  Fly   100 LD------ERALDALKEFP------------VDGAL---NVLGQFLESNLEHV-------SNKSA 136
            ..      .||:....::|            .:|:|   ::..|..|:.|..|       :.|.|
Human   542 TQHCRKALHRAVQCTSDYPEHVCEVLLTMERTEGSLEDWDIAVQKTETRLARVNEQRMKAAEKEA 606

  Fly   137 YLCGVMK---TYRQKSRASQQGVAAPATVKGP-----DED-----------------KIKKILER 176
            .|....:   ..|:::||.::.:.....::||     |||                 :::..:..
Human   607 ALVQQEEEKAEQRKRARAEKKALKKKKKIRGPEKRGADEDDEKEWGDDEEEQPSKRRRVENSIPA 671

  Fly   177 TGYTLDVTTGQRKYGGP----------PP--------HWEGNVP-------GNGCEVFCGKIPKD 216
            .|.|.:|...    .||          ||        ..:.::|       .:...||...:|..
Human   672 AGETQNVEVA----AGPAGKCAAVDVEPPSKQKEKAASLKRDMPKVLHDSSKDSITVFVSNLPYS 732

  Fly   217 MYEDE--LIPLFENCGIIWDLRLMMDPMTGTNRGYAFVTFTNREAAVNAVRQLNDFEIRTGKKIG 279
            |.|.:  |.||||.||.:..:|.:.. ..|..|||.:|.|...::|:.|        :...:|  
Human   733 MQEPDTKLRPLFEACGEVVQIRPIFS-NRGDFRGYCYVEFKEEKSALQA--------LEMDRK-- 786

  Fly   280 VTISFNNHRLFVGNIPKNRDRDELIEEFSKHAPGLYEVIIYSSP-DDKKKNRGFCFLEYESHKAA 343
               |.....:||                              || .||.||..|....|    :.
Human   787 ---SVEGRPMFV------------------------------SPCVDKSKNPDFKVFRY----ST 814

  Fly   344 SLAKRRLGTGRIKVWGCDIIVDWADPQEEPDEQTMSKVKVLYVRNLTQDVSEDKLKEQFEQYGKV 408
            ||.|.:                                  |::..|....::::|:|..:.:|.|
Human   815 SLEKHK----------------------------------LFISGLPFSCTKEELEEICKAHGTV 845

  Fly   409 E-------RVKKIKDYAFIHFEDRDSAVEAMRGLNGKEIGASNIEVSLAKPPSDK-KKKEEILRA 465
            :       |..|.|..|::.:|:...|.:|:..::|..|..:.|:|:::.||..| .:|.|..:|
Human   846 KDLRLVTNRAGKPKGLAYVEYENESQASQAVMKMDGMTIKENIIKVAISNPPQRKVPEKPETRKA 910

  Fly   466 RERRMMQMMQARPGIVGFETLSPYRNLSPTHPSIMSLTPMRPGARMP 512
            ....|:     .|...|      .|....|..|::.....||.|..|
Human   911 PGGPML-----LPQTYG------ARGKGRTQLSLLPRALQRPSAAAP 946

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SypNP_001262777.1 RRM1_hnRNPR_like 205..283 CDD:240695 22/79 (28%)
RRM2_hnRNPR_like 286..367 CDD:240696 13/81 (16%)
RRM3_hnRNPR_like 381..452 CDD:240697 17/77 (22%)
SART3XP_005269298.1 RNA14 100..>478 CDD:227438
NRDE-2 351..>504 CDD:285605 5/15 (33%)
RRM 654..876 CDD:223796 56/307 (18%)
RRM1_SART3 723..796 CDD:240837 25/116 (22%)
RRM2_SART3 817..897 CDD:240838 18/113 (16%)
LSM_int_assoc 895..951 CDD:293211 16/63 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.