DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syp and AT5G28390

DIOPT Version :9

Sequence 1:NP_001262777.1 Gene:Syp / 42460 FlyBaseID:FBgn0038826 Length:761 Species:Drosophila melanogaster
Sequence 2:NP_198191.2 Gene:AT5G28390 / 832924 AraportID:AT5G28390 Length:180 Species:Arabidopsis thaliana


Alignment Length:202 Identity:49/202 - (24%)
Similarity:84/202 - (41%) Gaps:56/202 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   364 VDWADPQEEPD-EQTMSKVKVLYVRNLTQDVSEDKLKEQFEQYGKVERV--------KKIKDYAF 419
            |.||:.:...: :.:.|:||.||::||.:|:::::||..||.:||:.:|        |:...|.|
plant    15 VSWAESRSGGEGDSSASQVKALYIKNLPRDITQERLKALFEHHGKILKVVIPPAKPGKEDSRYGF 79

  Fly   420 IHFEDRDSAVEAMRGLNGKEIGASNIEVSLAKPPSDKKKKEEILRARERRMMQMMQARPGIVGFE 484
            :|:.:|.|.:.|::.....||.||    :.::|                    :|.|.....|..
plant    80 VHYAERTSVMRALKNTERYEIDAS----AYSQP--------------------LMHAGGHAAGGM 120

  Fly   485 TLSPYRNLSPTHPSIMSLTP--------MRPG-ARMPLRTPIPREYDYFYDFFGFSDYRQGGSFG 540
            ::.|.            :.|        .:|| |.||  .|.||....:....|.|..:|....|
plant   121 SMMPI------------MLPDGRIRYVLQQPGLAAMP--QPPPRPSPPYRGGSGSSSSKQSSDNG 171

  Fly   541 NNVSYYD 547
            ...|.|:
plant   172 RGRSRYN 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SypNP_001262777.1 RRM1_hnRNPR_like 205..283 CDD:240695
RRM2_hnRNPR_like 286..367 CDD:240696 1/2 (50%)
RRM3_hnRNPR_like 381..452 CDD:240697 25/78 (32%)
AT5G28390NP_198191.2 RRM <15..>101 CDD:223796 26/85 (31%)
RRM_SF 33..103 CDD:302621 23/69 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0117
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.