DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syp and PSRP2

DIOPT Version :9

Sequence 1:NP_001262777.1 Gene:Syp / 42460 FlyBaseID:FBgn0038826 Length:761 Species:Drosophila melanogaster
Sequence 2:NP_001030841.1 Gene:PSRP2 / 824379 AraportID:AT3G52150 Length:253 Species:Arabidopsis thaliana


Alignment Length:251 Identity:56/251 - (22%)
Similarity:87/251 - (34%) Gaps:83/251 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   208 VFCGKIPKDMYEDELIPLFENCGIIWDLRLMMDPMTGTNRGYAFVTFTNREAAVNAVRQLNDFEI 272
            |:.|.||:.:..::|..|.|..|.:..:::|.|..:|.:|.:.|.|..:.|.|...|.:||...:
plant    78 VYIGNIPRTVTNEQLTKLVEEHGAVEKVQVMYDKYSGRSRRFGFATMKSVEDANAVVEKLNGNTV 142

  Fly   273 RTGKKIGVTISFNNHRLFVGNIPKNRDRDELIEEFSKHAPGLYEVIIYSSPDDKKKNRGFCFLEY 337
            . |::|.|.|:                                |..|.||||       ...|:.
plant   143 E-GREIKVNIT--------------------------------EKPIASSPD-------LSVLQS 167

  Fly   338 ESHKAASLAKRRLGTGRIKVWGCDIIVDWADPQEEPDEQTMSKVKVLYVRNLTQDVSEDKLKEQF 402
            |.                     ...||             |..|| ||.||.:.|:::.|:..|
plant   168 ED---------------------SAFVD-------------SPYKV-YVGNLAKTVTKEMLENLF 197

  Fly   403 EQYGKVERVK--------KIKDYAFIHFEDRDSAVEAMRGLNGKEIGASNIEVSLA 450
            .:.|||...|        |...:.|:.|...:....|:..||...:....|.|:.|
plant   198 SEKGKVVSAKVSRVPGTSKSTGFGFVTFSSEEDVEAAIVALNNSLLEGQKIRVNKA 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SypNP_001262777.1 RRM1_hnRNPR_like 205..283 CDD:240695 22/74 (30%)
RRM2_hnRNPR_like 286..367 CDD:240696 10/80 (13%)
RRM3_hnRNPR_like 381..452 CDD:240697 22/78 (28%)
PSRP2NP_001030841.1 RRM_SF 77..154 CDD:327398 23/108 (21%)
RRM <78..>253 CDD:330708 55/249 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1384330at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.