DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syp and Dnd1

DIOPT Version :9

Sequence 1:NP_001262777.1 Gene:Syp / 42460 FlyBaseID:FBgn0038826 Length:761 Species:Drosophila melanogaster
Sequence 2:NP_001102849.1 Gene:Dnd1 / 679841 RGDID:1583648 Length:352 Species:Rattus norvegicus


Alignment Length:234 Identity:78/234 - (33%)
Similarity:129/234 - (55%) Gaps:12/234 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 LERTGYTLDVTTGQRKYGGPPPHWEGNVPGNGCEVFCGKIPKDMYEDELIPLFENCGIIWDLRLM 238
            :..||..|....||||||||||.|.|:.|.:|.|||.|::|:|:||.:|||||:..|.:::.|||
  Rat    26 VRETGIRLVQVNGQRKYGGPPPGWVGSPPPSGSEVFIGRLPQDVYEHQLIPLFQRVGRLYEFRLM 90

  Fly   239 MDPMTGTNRGYAFVTFTNREAAVNAVRQLNDFEIRTGKKIGVTISFNNHRLFVGNIPKNRDRDEL 303
            | ..:|.|||:|:..:::|..|..|:..|::.::|...::.|..|.....|.|..:|.:.:|..|
  Rat    91 M-TFSGLNRGFAYARYSSRRGAQAAIATLHNHQLRPSCQLLVCRSTEKCELTVDGLPLSLNRRAL 154

  Fly   304 IEEFSKHAPGLYEVIIYSSPDDKKKNRGFCFLEYESHKAASLAKRRLGTGRIKVWGCDIIVDWAD 368
            :.......|.|.|.::..||......  ...|::.:|:||::||:.|..|:.::.|..:.|:|..
  Rat   155 LLALQPLGPCLQETLLLPSPGSAPSQ--IALLKFSTHRAAAMAKKALVEGQSRLCGEQVAVEWLK 217

  Fly   369 PQ-EEPDEQTMSKVKVLYVRNLTQDVSE-----DKLKEQ 401
            |. ::...|.::...:.::|   .|||:     |||..|
  Rat   218 PDLKQHFRQQLAGPSLRFLR---PDVSQLAQTRDKLGSQ 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SypNP_001262777.1 RRM1_hnRNPR_like 205..283 CDD:240695 30/77 (39%)
RRM2_hnRNPR_like 286..367 CDD:240696 20/80 (25%)
RRM3_hnRNPR_like 381..452 CDD:240697 8/26 (31%)
Dnd1NP_001102849.1 hnRNP-R-Q 18..>219 CDD:273732 68/195 (35%)
DSRM_DND1 254..333 CDD:380745 78/234 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0117
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1384330at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.