DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syp and sqd

DIOPT Version :10

Sequence 1:NP_001262777.1 Gene:Syp / 42460 FlyBaseID:FBgn0038826 Length:761 Species:Drosophila melanogaster
Sequence 2:NP_731825.1 Gene:sqd / 41666 FlyBaseID:FBgn0263396 Length:344 Species:Drosophila melanogaster


Alignment Length:423 Identity:96/423 - (22%)
Similarity:135/423 - (31%) Gaps:168/423 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   207 EVFCGKIPKDMYEDELIPLFENCGIIWDLRLMMDPMTGTNRGYAFVTFTNREAAVNAVRQLNDFE 271
            ::|.|.:..:..|.||...|...|.|..:.:..||.||.:||:||:.|||.||            
  Fly    57 KLFVGGLSWETTEKELRDHFGKYGEIESINVKTDPQTGRSRGFAFIVFTNTEA------------ 109

  Fly   272 IRTGKKIGVTISFNNHRLFVGNIPKNRDRDELIEEFSKHAPGLYEVIIYSSPDDKKKNRGFCFLE 336
                                  |.|....||       |       ||.|...|.||        
  Fly   110 ----------------------IDKVSAADE-------H-------IINSKKVDPKK-------- 130

  Fly   337 YESHKAASLAKRRLGTGRIKVWGCDIIVDWADPQEEPDEQTMSKVKVLYVRNLTQDVSEDKLKEQ 401
                     ||.|.|.                               ::|..||.::|::::|..
  Fly   131 ---------AKARHGK-------------------------------IFVGGLTTEISDEEIKTY 155

  Fly   402 FEQYGKVERVK--------KIKDYAFIHFEDRDSAVEAMRGLNGKEIGASNIEVSLAKPPSDKKK 458
            |.|:|.:..|:        :.|.:.||.| |.:..|..:.....::|....::|..|.|..    
  Fly   156 FGQFGNIVEVEMPFDKQKSQRKGFCFITF-DSEQVVTDLLKTPKQKIAGKEVDVKRATPKP---- 215

  Fly   459 KEEILRARERRMMQMMQARP------GIVGFETLSPYRNLSPTHPSIMSLTPMRPGARMPLRTPI 517
                    |.:||..|:..|      |..|:.....|.|                          
  Fly   216 --------ENQMMGGMRGGPRGGMRGGRGGYGGRGGYNN-------------------------- 246

  Fly   518 PREYDYFYDFFGFSDYRQGGSFGNNVSYYDDMYRWIDGDYNYYDYPNGG---GGG------SGGG 573
              ::|....:.|:.    ||..|.....|.|.|  ..|.||.|||...|   |||      .|||
  Fly   247 --QWDGQGSYGGYG----GGYGGYGAGGYGDYY--AGGYYNGYDYGYDGYGYGGGFEGNGYGGGG 303

  Fly   574 GGSVSGGTVLPLSAGGSQNSPMASG--QRSARG 604
            ||::.||...|...||.:.....:|  ||...|
  Fly   304 GGNMGGGRGGPRGGGGPKGGGGFNGGKQRGGGG 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SypNP_001262777.1 NURR_Syncrip-like 68..150 CDD:410953
hnRNP-R-Q 153..>563 CDD:273732 77/369 (21%)
sqdNP_731825.1 RRM1_hnRNPA_hnRNPD_like 58..129 CDD:409763 30/118 (25%)
RRM2_hnRNPD_like 137..211 CDD:240775 17/105 (16%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.