DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syp and sqd

DIOPT Version :9

Sequence 1:NP_001262777.1 Gene:Syp / 42460 FlyBaseID:FBgn0038826 Length:761 Species:Drosophila melanogaster
Sequence 2:NP_731825.1 Gene:sqd / 41666 FlyBaseID:FBgn0263396 Length:344 Species:Drosophila melanogaster


Alignment Length:423 Identity:96/423 - (22%)
Similarity:135/423 - (31%) Gaps:168/423 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   207 EVFCGKIPKDMYEDELIPLFENCGIIWDLRLMMDPMTGTNRGYAFVTFTNREAAVNAVRQLNDFE 271
            ::|.|.:..:..|.||...|...|.|..:.:..||.||.:||:||:.|||.||            
  Fly    57 KLFVGGLSWETTEKELRDHFGKYGEIESINVKTDPQTGRSRGFAFIVFTNTEA------------ 109

  Fly   272 IRTGKKIGVTISFNNHRLFVGNIPKNRDRDELIEEFSKHAPGLYEVIIYSSPDDKKKNRGFCFLE 336
                                  |.|....||       |       ||.|...|.||        
  Fly   110 ----------------------IDKVSAADE-------H-------IINSKKVDPKK-------- 130

  Fly   337 YESHKAASLAKRRLGTGRIKVWGCDIIVDWADPQEEPDEQTMSKVKVLYVRNLTQDVSEDKLKEQ 401
                     ||.|.|.                               ::|..||.::|::::|..
  Fly   131 ---------AKARHGK-------------------------------IFVGGLTTEISDEEIKTY 155

  Fly   402 FEQYGKVERVK--------KIKDYAFIHFEDRDSAVEAMRGLNGKEIGASNIEVSLAKPPSDKKK 458
            |.|:|.:..|:        :.|.:.||.| |.:..|..:.....::|....::|..|.|..    
  Fly   156 FGQFGNIVEVEMPFDKQKSQRKGFCFITF-DSEQVVTDLLKTPKQKIAGKEVDVKRATPKP---- 215

  Fly   459 KEEILRARERRMMQMMQARP------GIVGFETLSPYRNLSPTHPSIMSLTPMRPGARMPLRTPI 517
                    |.:||..|:..|      |..|:.....|.|                          
  Fly   216 --------ENQMMGGMRGGPRGGMRGGRGGYGGRGGYNN-------------------------- 246

  Fly   518 PREYDYFYDFFGFSDYRQGGSFGNNVSYYDDMYRWIDGDYNYYDYPNGG---GGG------SGGG 573
              ::|....:.|:.    ||..|.....|.|.|  ..|.||.|||...|   |||      .|||
  Fly   247 --QWDGQGSYGGYG----GGYGGYGAGGYGDYY--AGGYYNGYDYGYDGYGYGGGFEGNGYGGGG 303

  Fly   574 GGSVSGGTVLPLSAGGSQNSPMASG--QRSARG 604
            ||::.||...|...||.:.....:|  ||...|
  Fly   304 GGNMGGGRGGPRGGGGPKGGGGFNGGKQRGGGG 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SypNP_001262777.1 RRM1_hnRNPR_like 205..283 CDD:240695 21/75 (28%)
RRM2_hnRNPR_like 286..367 CDD:240696 15/80 (19%)
RRM3_hnRNPR_like 381..452 CDD:240697 18/78 (23%)
sqdNP_731825.1 RRM_SF 58..129 CDD:302621 30/118 (25%)
RRM2_hnRNPD_like 137..211 CDD:240775 17/105 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464013
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.