DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Syp and SLIRP2

DIOPT Version :9

Sequence 1:	NP_001262777.1	Gene:	Syp / 42460	FlyBaseID:	FBgn0038826	Length:	761	Species:	Drosophila melanogaster
Sequence 2:	NP_649808.1	Gene:	SLIRP2 / 41021	FlyBaseID:	FBgn0037602	Length:	91	Species:	Drosophila melanogaster

Alignment Length:	64	Identity:	18/64 - (28%)
Similarity:	31/64 - (48%)	Gaps:	0/64 - (0%)

- Green bases have known domain annotations that are detailed below.

  Fly   207 EVFCGKIPKDMYEDELIPLFENCGIIWDLRLMMDPMTGTNRGYAFVTFTNREAAVNAVRQLNDF 270
            ::|.|.:|..:...||...|...|.:.:..::.|...|.::.|.||.|:.|:|..:|..|...|
  Fly    11 KLFVGNLPWTIGSKELRTYFSKYGHVANAEVVFDRQLGLSKHYGFVVFSQRDAFNSASNQNTHF 74

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Syp	NP_001262777.1	RRM1_hnRNPR_like	205..283	CDD:240695	18/64 (28%)
		RRM2_hnRNPR_like	286..367	CDD:240696
		RRM3_hnRNPR_like	381..452	CDD:240697
SLIRP2	NP_649808.1	RRM_SLIRP	11..83	CDD:240688	18/64 (28%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C45463999
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
	1	0.930