DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syp and hnrnpr

DIOPT Version :9

Sequence 1:NP_001262777.1 Gene:Syp / 42460 FlyBaseID:FBgn0038826 Length:761 Species:Drosophila melanogaster
Sequence 2:NP_998591.1 Gene:hnrnpr / 406735 ZFINID:ZDB-GENE-040426-2766 Length:214 Species:Danio rerio


Alignment Length:185 Identity:113/185 - (61%)
Similarity:139/185 - (75%) Gaps:11/185 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 RTEDYPKLLEYGLDKKVAGKLDEIYKTGK------LAHAELDERALDALKEFPVDGALNVLGQFL 124
            |:|:|..||:.||.:|||..||.|::||:      :|:|:|||||||||:||..:|||:||.||.
Zfish    25 RSENYQALLDAGLPQKVAESLDNIFQTGESAEHGLVAYADLDERALDALREFNEEGALSVLQQFK 89

  Fly   125 ESNLEHVSNKSAYLCGVMKTYRQKSRASQQGVAAPATVKGPDEDKIKKILERTGYTLDVTTGQRK 189
            ||:|.||.||||:||||||||||:.:   ||.....:.|||||.|||.:|:||||||||||||||
Zfish    90 ESDLSHVQNKSAFLCGVMKTYRQREK---QGNKVQESSKGPDETKIKALLDRTGYTLDVTTGQRK 151

  Fly   190 YGGPPPH--WEGNVPGNGCEVFCGKIPKDMYEDELIPLFENCGIIWDLRLMMDPM 242
            ||||||.  :.|..||.|.|||.||||:|:|||||:||||..|.|||||..:.|:
Zfish   152 YGGPPPDAVFSGPQPGIGTEVFVGKIPRDLYEDELVPLFEKAGSIWDLRRDVWPL 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SypNP_001262777.1 RRM1_hnRNPR_like 205..283 CDD:240695 25/38 (66%)
RRM2_hnRNPR_like 286..367 CDD:240696
RRM3_hnRNPR_like 381..452 CDD:240697
hnrnprNP_998591.1 RRM_SF 169..>200 CDD:302621 22/30 (73%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 103 1.000 Domainoid score I6729
eggNOG 1 0.900 - - E1_KOG0117
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 539 1.000 Inparanoid score I1150
OMA 1 1.010 - - QHG49453
OrthoDB 1 1.010 - - D1384330at2759
OrthoFinder 1 1.000 - - FOG0000581
OrthoInspector 1 1.000 - - otm25257
orthoMCL 1 0.900 - - OOG6_104511
Panther 1 1.100 - - LDO PTHR21245
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X331
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1211.880

Return to query results.
Submit another query.