DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syp and CG2931

DIOPT Version :9

Sequence 1:NP_001262777.1 Gene:Syp / 42460 FlyBaseID:FBgn0038826 Length:761 Species:Drosophila melanogaster
Sequence 2:NP_649552.1 Gene:CG2931 / 40673 FlyBaseID:FBgn0037342 Length:302 Species:Drosophila melanogaster


Alignment Length:182 Identity:36/182 - (19%)
Similarity:81/182 - (44%) Gaps:39/182 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   303 LIEEFSKHAPGLYEVIIYSSPDDKKKNRGFCFLEYESHKAASLAKRRLGTGRIKVWGCDIIVDWA 367
            :.||..|.|.....:..:.:.:.|||:|          |...:|.   ||    ||....:.|| 
  Fly   147 IAEEAIKAARASSALQSFQTTERKKKDR----------KTVRIAG---GT----VWEDTSLADW- 193

  Fly   368 DPQEEPDEQTMSKVKVLYVRNLTQDVSEDKLKEQFEQYGKVERVKKIKD--------YAFIHFED 424
                 ||:...     ::..:|..||:::.|...|.::...:|.:.::|        :.|:.|.:
  Fly   194 -----PDDDFR-----IFCGDLGNDVNDEVLTRTFNKFPSFQRARVVRDKRTGKSKGFGFVSFRE 248

  Fly   425 RDSAVEAMRGLNGKEIGASNIEVSLAKPPSDKKKKEEILRARERRMMQMMQA 476
            ....:.||:.::|:.:|:..|::   :..:.:::..::::.:||....::||
  Fly   249 PADFIRAMKEMDGRYVGSRPIKL---RKSTWRQRSLDVVKKKEREKQVLLQA 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SypNP_001262777.1 RRM1_hnRNPR_like 205..283 CDD:240695
RRM2_hnRNPR_like 286..367 CDD:240696 15/63 (24%)
RRM3_hnRNPR_like 381..452 CDD:240697 14/78 (18%)
CG2931NP_649552.1 RRM_RBM42 192..274 CDD:240829 18/95 (19%)
RRM <194..>280 CDD:223796 16/93 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464018
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.