DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syp and CG3335

DIOPT Version :9

Sequence 1:NP_001262777.1 Gene:Syp / 42460 FlyBaseID:FBgn0038826 Length:761 Species:Drosophila melanogaster
Sequence 2:NP_648337.1 Gene:CG3335 / 39119 FlyBaseID:FBgn0036018 Length:918 Species:Drosophila melanogaster


Alignment Length:524 Identity:104/524 - (19%)
Similarity:188/524 - (35%) Gaps:170/524 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 SRTILKTPSSFRTPSPIPSCSKMAEGNGELLDDINQKADDRGDGERTEDYPKLLEYGLDKKVAGK 85
            ||..:::.::..:.....|.||.|:.:.:.||.:.:|                     :::.|.|
  Fly    70 SRVRVESCAALGSEDKPQSWSKYAKDSKKNLDKLKEK---------------------EREAAAK 113

  Fly    86 LDEIYKTGKLAHAELDERALDALKEFPVDGALNVLGQFLESNLEHVSNKSAYL----CGVMKT-- 144
            ..|..|..|....:..::.|...|:.|      ...:|||::     :||..|    .|:.|.  
  Fly   114 AKESEKKKKKDKVDKVDQILSRHKDDP------EFQEFLEAH-----DKSRTLWGNDLGINKNRE 167

  Fly   145 -------YRQKSRASQ--QGVAAPATVKGPDEDKIKKILERTGYTLDVTTGQRKYGGPPPHWEGN 200
                   .:::|||::  .||.|.|    .|||                                
  Fly   168 NEEEDDEEQEESRAARDDSGVDADA----GDED-------------------------------- 196

  Fly   201 VPGNGCEVFCGKIPKDMYEDELIPLFENCGIIWDLRLMMDPMTGTNRGYAFVTFTNREAAVNAVR 265
              |:|.|.       |..||.            | :|...|::......:.:..|:.||      
  Fly   197 --GSGDEA-------DEEEDT------------D-KLAEKPISDLEYMKSLMATTSGEA------ 233

  Fly   266 QLNDFEIRTGKKIGVTISFNNHRLF---VGNIPKNRDRDELIEEFSKHAPGLYEVIIYSSPDDKK 327
                    |.||.......:|..||   :.|:|.|..|.|:::.|....|  |.|.:.|      
  Fly   234 --------TAKKPKAKADKSNLELFTIKIHNVPYNTKRQEVLKFFKPLKP--YSVRLPS------ 282

  Fly   328 KNRGFCFLEYESHK--AASLAKRRLGTGRIKVWGCDI-------------------IVD-----W 366
            |..|||::.:::.|  |..:.|.:......:|:..|.                   .||     |
  Fly   283 KVHGFCYVGFKTEKDMAKGMLKNKSFIKGKQVFFSDFTEKNKVTKASKSGQPLAPAAVDAGNAKW 347

  Fly   367 ADPQEE-PDEQTMSKVKVLYVRNLTQDVSEDKLKEQFEQYGKVERV--------KKIKDYAFIHF 422
            ...|:. ..|..:|:...::.|||....:|:.|::.|||:|.|..|        :|||.:..:.:
  Fly   348 KHQQDSLSKEDDISESGRIFFRNLAYTTTEEDLRKLFEQFGPVVEVNLPLDKLTRKIKGFGTVTY 412

  Fly   423 EDRDSAVEAMRGLNGKEIGASNIEVSLAK-----PPSDKKKKEEILRARERRMMQMMQARPGIVG 482
            ...:.|::|...|:|.:.....:.:..:|     |..|..:.:..|..:|::.:::.:.....:|
  Fly   413 MMPEHALKAFNTLDGTDFHGRLLHLLPSKDIEKNPKEDLDENDASLSFKEKKALKLKKNAQKPIG 477

  Fly   483 FETL 486
            :.||
  Fly   478 WNTL 481

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SypNP_001262777.1 RRM1_hnRNPR_like 205..283 CDD:240695 14/77 (18%)
RRM2_hnRNPR_like 286..367 CDD:240696 24/109 (22%)
RRM3_hnRNPR_like 381..452 CDD:240697 19/83 (23%)
CG3335NP_648337.1 RRM1_RBM19 2..77 CDD:241008 2/6 (33%)
RRM_SF 250..314 CDD:302621 18/71 (25%)
RRM3_RBM19 362..440 CDD:241011 18/77 (23%)
RRM4_RBM19 552..623 CDD:241013
RRM <638..845 CDD:223796
RRM5_RBM19_like 679..760 CDD:240764
RRM6_RBM19 785..864 CDD:241015
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464014
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.