| Sequence 1: | NP_001262777.1 | Gene: | Syp / 42460 | FlyBaseID: | FBgn0038826 | Length: | 761 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001027083.1 | Gene: | SLIRP1 / 3772560 | FlyBaseID: | FBgn0064117 | Length: | 90 | Species: | Drosophila melanogaster |
| Alignment Length: | 52 | Identity: | 16/52 - (30%) |
|---|---|---|---|
| Similarity: | 26/52 - (50%) | Gaps: | 0/52 - (0%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 208 VFCGKIPKDMYEDELIPLFENCGIIWDLRLMMDPMTGTNRGYAFVTFTNREA 259 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Syp | NP_001262777.1 | NURR_Syncrip-like | 68..150 | CDD:410953 | |
| hnRNP-R-Q | 153..>563 | CDD:273732 | 16/52 (31%) | ||
| SLIRP1 | NP_001027083.1 | RRM_SLIRP | 16..88 | CDD:409688 | 16/52 (31%) |
| Blue background indicates that the domain is not in the aligned region. | |||||