DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syp and SLIRP1

DIOPT Version :10

Sequence 1:NP_001262777.1 Gene:Syp / 42460 FlyBaseID:FBgn0038826 Length:761 Species:Drosophila melanogaster
Sequence 2:NP_001027083.1 Gene:SLIRP1 / 3772560 FlyBaseID:FBgn0064117 Length:90 Species:Drosophila melanogaster


Alignment Length:52 Identity:16/52 - (30%)
Similarity:26/52 - (50%) Gaps:0/52 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   208 VFCGKIPKDMYEDELIPLFENCGIIWDLRLMMDPMTGTNRGYAFVTFTNREA 259
            :|.|.:|..:...||...|...|.:....::.|..||.::||.||:|.:..|
  Fly    17 IFVGNLPWTVGHQELRGYFREFGRVVSANVIFDKRTGCSKGYGFVSFNSLTA 68

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SypNP_001262777.1 NURR_Syncrip-like 68..150 CDD:410953
hnRNP-R-Q 153..>563 CDD:273732 16/52 (31%)
SLIRP1NP_001027083.1 RRM_SLIRP 16..88 CDD:409688 16/52 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.