DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syp and Secp43

DIOPT Version :9

Sequence 1:NP_001262777.1 Gene:Syp / 42460 FlyBaseID:FBgn0038826 Length:761 Species:Drosophila melanogaster
Sequence 2:NP_608837.2 Gene:Secp43 / 33652 FlyBaseID:FBgn0031607 Length:336 Species:Drosophila melanogaster


Alignment Length:269 Identity:57/269 - (21%)
Similarity:91/269 - (33%) Gaps:101/269 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   206 CEVFCGKIPKDMYEDELIPLFENCGIIWD---LRLMMDPMTGTNRGYAFVTFTNREAAVNAVRQL 267
            |:::.|.:...|.|:.:|..|...|  .|   :|||.:..||...||.||.|.:.:.|::|:.:|
  Fly     6 CQLWMGSLESYMTENFIIAAFRKMG--EDPTTVRLMRNKYTGEPAGYCFVNFISDDHALDAMHKL 68

  Fly   268 NDFEIRTGKKIGVTISFNNHRLFVGNIPKNRDRDELIEEFSKHAPGLYEVIIYSSPDDKKKNRGF 332
            |      ||.|..|......||   |...|.                     |..|.::::    
  Fly    69 N------GKPIPGTNPIVRFRL---NSASNS---------------------YKLPGNERE---- 99

  Fly   333 CFLEYESHKAASLAKRRLGTGRIKVWGCDIIVDWADPQEEPDEQTMSKVKVLYVRNLTQDVSEDK 397
                                  ..||                           |.:|:.||.:.:
  Fly   100 ----------------------FSVW---------------------------VGDLSSDVDDYQ 115

  Fly   398 LKEQF-EQYGKVERVKKI-------KDYAFIHFEDRDSAVEAMRGLNGK-EIGASNIEVSLAKPP 453
            |.:.| .::..::..|.|       |.|.|:.|...|....|:..:||. .:|...|::..|.| 
  Fly   116 LYKVFSSKFTSIKTAKVILDSLGFSKGYGFVRFGIEDEQKSALYDMNGYIGLGTKPIKICNAVP- 179

  Fly   454 SDKKKKEEI 462
               |.|.|:
  Fly   180 ---KPKSEL 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SypNP_001262777.1 RRM1_hnRNPR_like 205..283 CDD:240695 26/79 (33%)
RRM2_hnRNPR_like 286..367 CDD:240696 8/80 (10%)
RRM3_hnRNPR_like 381..452 CDD:240697 19/79 (24%)
Secp43NP_608837.2 RRM1_SECp43 7..90 CDD:241054 28/93 (30%)
RRM2_SECp43 99..180 CDD:241056 22/137 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463927
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.