DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syp and CG14414

DIOPT Version :10

Sequence 1:NP_001262777.1 Gene:Syp / 42460 FlyBaseID:FBgn0038826 Length:761 Species:Drosophila melanogaster
Sequence 2:NP_001285240.1 Gene:CG14414 / 32394 FlyBaseID:FBgn0030571 Length:213 Species:Drosophila melanogaster


Alignment Length:119 Identity:37/119 - (31%)
Similarity:51/119 - (42%) Gaps:24/119 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   191 GGPPPH----WEGNVPGNGCEVFCGKIPKDMYEDELIPLFENCGIIWDLRLMM---DPMTGTNRG 248
            ||.|..    |.||:.....:..| ..|   |..:|:.|.:.||.|....::.   .||.|.:||
  Fly    20 GGNPEEARRIWVGNLDSRITDSIC-IAP---YRFQLLKLMQKCGAIEKFDMLFHKGGPMVGQSRG 80

  Fly   249 YAFVTFTNREAAVNAVRQLNDFEIRTGKKIGVTISFNNHRLFVGNIPKNRDRDE 302
            ||||||...|.|.||:.:|:      |..:|       :|.....:.||...||
  Fly    81 YAFVTFAQNEGATNALLKLD------GTSVG-------NRSIAVRLAKNIKYDE 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SypNP_001262777.1 NURR_Syncrip-like 68..150 CDD:410953
hnRNP-R-Q 153..>563 CDD:273732 37/119 (31%)
CG14414NP_001285240.1 RRM_RBM18 28..115 CDD:409791 30/103 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.