DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syp and Dnd1

DIOPT Version :9

Sequence 1:NP_001262777.1 Gene:Syp / 42460 FlyBaseID:FBgn0038826 Length:761 Species:Drosophila melanogaster
Sequence 2:NP_775559.2 Gene:Dnd1 / 213236 MGIID:2447763 Length:352 Species:Mus musculus


Alignment Length:233 Identity:76/233 - (32%)
Similarity:129/233 - (55%) Gaps:10/233 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 LERTGYTLDVTTGQRKYGGPPPHWEGNVPGNGCEVFCGKIPKDMYEDELIPLFENCGIIWDLRLM 238
            :..||..|....||||||||||.|.|:.|.:|.||:.|::|:|:||.:|||||:..|.:::.|||
Mouse    26 VRETGIRLVQVNGQRKYGGPPPGWVGSPPPSGSEVYIGRLPQDVYEHQLIPLFQRVGRLYEFRLM 90

  Fly   239 MDPMTGTNRGYAFVTFTNREAAVNAVRQLNDFEIRTGKKIGVTISFNNHRLFVGNIPKNRDRDEL 303
            | ..:|.|||:|:..:::|..|..|:..|::.::|...::.|..|.....|.|..:|.:.:|..|
Mouse    91 M-TFSGLNRGFAYARYSSRRGAQAAIATLHNHQLRPSCQLLVCRSTEKCELTVDGLPLSLNRRAL 154

  Fly   304 IEEFSKHAPGLYEVIIYSSPDDKKKNRGFCFLEYESHKAASLAKRRLGTGRIKVWGCDIIVDWAD 368
            :.......|.|.|.::..||......  ...|::.:|:||::||:.|..|:.::.|..:.|:|..
Mouse   155 LLALQPFGPCLQETLLLPSPGSAPSQ--IALLKFSTHRAAAMAKKALVEGQSRLCGEQVAVEWLK 217

  Fly   369 PQ-EEPDEQTMSKVKVLYVR----NLTQDVSEDKLKEQ 401
            |. ::...|.::...:.::|    .|||  :.:||..|
Mouse   218 PDLKQHFRQQLAGPSLRFLRPDVSQLTQ--TREKLGSQ 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SypNP_001262777.1 RRM1_hnRNPR_like 205..283 CDD:240695 29/77 (38%)
RRM2_hnRNPR_like 286..367 CDD:240696 20/80 (25%)
RRM3_hnRNPR_like 381..452 CDD:240697 7/25 (28%)
Dnd1NP_775559.2 RRM1_DND1 57..134 CDD:240931 29/77 (38%)
RRM_SF 136..218 CDD:302621 21/83 (25%)
DND1_DSRM 253..333 CDD:291380 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0117
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1384330at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.