DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4T1 and Psmb1

DIOPT Version :9

Sequence 1:NP_650910.1 Gene:Prosalpha4T1 / 42457 FlyBaseID:FBgn0265606 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_446042.1 Gene:Psmb1 / 94198 RGDID:621092 Length:240 Species:Rattus norvegicus


Alignment Length:227 Identity:38/227 - (16%)
Similarity:82/227 - (36%) Gaps:42/227 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 IFSPDGHL--LQVEYAQEAVRKGSTAVGVRGANCVVLGVEKSSVSEMQEDRTVR-----KISMLD 68
            :..|.|..  :|:.::..|. .|.|.:.:.|.:..::    :|.:.:.|..::.     |...|.
  Rat    15 VMGPQGSAGPVQMRFSPYAF-NGGTVLAIAGEDFSIV----ASDTRLSEGFSIHTRDSPKCYKLT 74

  Fly    69 RHVALAFAGLTADARILINRGQVECQSHRLNFENQVTLEYITRYLAQLKQKYTQCNGRR--PFGI 131
            ....:..:|...|...|....:...:.::.:....:|...|...|:      |....||  |:.:
  Rat    75 DKTVIGCSGFHGDCLTLTKIIEARLKMYKHSNNKAMTTGAIAAMLS------TILYSRRFFPYYV 133

  Fly   132 SCLIGGIDADGSARLFHTEPSGIFHEYKATATGRWANTVREFFEKAYSDHEVTTKCDAIKLAMRA 196
            ..:|.|:|.:|...::..:|.|.:......|.|..:..::...     |::|..|          
  Rat   134 YNIIEGLDEEGKGAVYSFDPVGSYQRDSFKAGGSASAMLQPLL-----DNQVGFK---------- 183

  Fly   197 LLEVTQMSQMRLEVAVLENGKPMKMLDSVVIS 228
                   :...:|...|...:.|:::..|.||
  Rat   184 -------NMQNVEHVPLTLDRAMRLVKDVFIS 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4T1NP_650910.1 PRK03996 5..239 CDD:235192 38/227 (17%)
proteasome_alpha_type_7 5..213 CDD:239724 33/210 (16%)
Psmb1NP_446042.1 proteasome_beta_type_1 29..240 CDD:239726 35/213 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.