DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4T1 and PUP3

DIOPT Version :9

Sequence 1:NP_650910.1 Gene:Prosalpha4T1 / 42457 FlyBaseID:FBgn0265606 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_011020.3 Gene:PUP3 / 856830 SGDID:S000000896 Length:205 Species:Saccharomyces cerevisiae


Alignment Length:116 Identity:28/116 - (24%)
Similarity:46/116 - (39%) Gaps:16/116 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 GSTAVGVRGANCVV------LGVEKSSVSEMQEDRTVRKISMLDRHVALAFAGLTADARILINRG 89
            |...|.:.|.:||.      ||.:...||...|     ||.... ||.|...||..|...|....
Yeast     9 GGIVVAMTGKDCVAIACDLRLGSQSLGVSNKFE-----KIFHYG-HVFLGITGLATDVTTLNEMF 67

  Fly    90 QVECQSHRLNFENQVTLEYITRYLAQLKQKYTQCNGRRPFGISCLIGGIDA 140
            :.:...::|..|..:..|..|:.::  ...|.:..|  |:.:..::.||::
Yeast    68 RYKTNLYKLKEERAIEPETFTQLVS--SSLYERRFG--PYFVGPVVAGINS 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4T1NP_650910.1 PRK03996 5..239 CDD:235192 28/116 (24%)
proteasome_alpha_type_7 5..213 CDD:239724 28/116 (24%)
PUP3NP_011020.3 proteasome_beta_type_3 8..201 CDD:239728 28/116 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.