DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4T1 and PUP2

DIOPT Version :9

Sequence 1:NP_650910.1 Gene:Prosalpha4T1 / 42457 FlyBaseID:FBgn0265606 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_011769.1 Gene:PUP2 / 853168 SGDID:S000003485 Length:260 Species:Saccharomyces cerevisiae


Alignment Length:250 Identity:85/250 - (34%)
Similarity:138/250 - (55%) Gaps:21/250 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SRYGRALTIFSPDGHLLQVEYAQEAVRKGSTAVGVRGANCVVLGVEKSSVSEMQEDRTVRKISML 67
            |.|.|.::.|||:|.|.||||:.||::.||||:|:.....|||||||.:.|.:.|..::.||..:
Yeast     6 SEYDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGIATKEGVVLGVEKRATSPLLESDSIEKIVEI 70

  Fly    68 DRHVALAFAGLTADARILINRGQVECQSHRLNFENQVTLEYITRYLAQLKQKYTQ-CNGR----- 126
            |||:..|.:|||||||.:|...:....:|.|.::..:.:|.:|:.:..|..::.: .:|.     
Yeast    71 DRHIGCAMSGLTADARSMIEHARTAAVTHNLYYDEDINVESLTQSVCDLALRFGEGASGEERLMS 135

  Fly   127 RPFGISCLIGGIDADGSARLFHTEPSGIFHEYKATA-----TGRWANTVREFFEKAYSDHEVTTK 186
            ||||::.||.|.|||...:|||.||||.|:.|.|.|     .|..|..:.|:       |...|.
Yeast   136 RPFGVALLIAGHDADDGYQLFHAEPSGTFYRYNAKAIGSGSEGAQAELLNEW-------HSSLTL 193

  Fly   187 CDAIKLAMRALLEVTQ--MSQMRLEVAVLENGKPMKMLDSVVISEIVKIVQNEKE 239
            .:|..|.::.|.:|.:  :.:...:::.:......|:.|:...:|::|.:: |||
Yeast   194 KEAELLVLKILKQVMEEKLDENNAQLSCITKQDGFKIYDNEKTAELIKELK-EKE 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4T1NP_650910.1 PRK03996 5..239 CDD:235192 82/246 (33%)
proteasome_alpha_type_7 5..213 CDD:239724 77/220 (35%)
PUP2NP_011769.1 proteasome_alpha_type_5 8..222 CDD:239722 77/220 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.