DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4T1 and PBC2

DIOPT Version :10

Sequence 1:NP_650910.1 Gene:Prosalpha4T1 / 42457 FlyBaseID:FBgn0265606 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_565156.1 Gene:PBC2 / 844080 AraportID:AT1G77440 Length:204 Species:Arabidopsis thaliana


Alignment Length:112 Identity:26/112 - (23%)
Similarity:49/112 - (43%) Gaps:5/112 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 GSTAVGVRGANCVVLGVEKSSVSEMQEDRT-VRKISMLDRHVALAFAGLTADARILINRGQVECQ 94
            ||..|.:.|.||..:..::....::|...| .::||.:..|:.:..:||..|.:.|..|.....:
plant     8 GSAVVAMVGKNCFAIASDRRLGVQLQTIATDFQRISKIHDHLFIGLSGLATDVQTLYQRLVFRHK 72

  Fly    95 SHRLNFENQVTLEYITRYLAQLKQKYTQCNGRRPFGISCLIGGIDAD 141
            .::|..|..:..|.....::.:  .|.:..|  ||....:|.|:..|
plant    73 LYQLREERDMKPETFASLVSAI--LYEKRFG--PFLCQPVIAGLGDD 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4T1NP_650910.1 proteasome_alpha_type_7 5..213 CDD:239724 26/112 (23%)
PBC2NP_565156.1 proteasome_beta_type_3 6..200 CDD:239728 26/112 (23%)

Return to query results.
Submit another query.