DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4T1 and PAE1

DIOPT Version :9

Sequence 1:NP_650910.1 Gene:Prosalpha4T1 / 42457 FlyBaseID:FBgn0265606 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001077717.1 Gene:PAE1 / 841822 AraportID:AT1G53850 Length:237 Species:Arabidopsis thaliana


Alignment Length:207 Identity:79/207 - (38%)
Similarity:118/207 - (57%) Gaps:14/207 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SRYGRALTIFSPDGHLLQVEYAQEAVRKGSTAVGVRGANCVVLGVEKSSVSEMQEDRTVRKISML 67
            :.|.|.:..|||:|.|.|||||.||::.||||:||:....|||.|||...|.:.|..:|.||..:
plant     6 TEYDRGVNTFSPEGRLFQVEYAIEAIKLGSTAIGVKTKEGVVLAVEKRITSPLLEPSSVEKIMEI 70

  Fly    68 DRHVALAFAGLTADARILINRGQVECQSHRLNFENQVTLEYITRYLAQLKQKYTQCNGR---RPF 129
            |.|:..|.:||.||||.|:...:||.|:||.::...:|:|..|:.|..|..::.:....   |||
plant    71 DDHIGCAMSGLIADARTLVEHARVETQNHRFSYGEPMTVESTTQALCDLALRFGEGEEESMSRPF 135

  Fly   130 GISCLIGGIDADGSARLFHTEPSGIFHEYKATATGRWA----NTVREFFEKAYSDHEVTTKCDAI 190
            |:|.||.|.|.:|.: |::|:|||.|.:..|.|.|..:    ::::|.|.|..|..|..|     
plant   136 GVSLLIAGHDENGPS-LYYTDPSGTFWQCNAKAIGSGSEGADSSLQEQFNKDLSLQEAET----- 194

  Fly   191 KLAMRALLEVTQ 202
             :|:..|.:|.:
plant   195 -IAVSILKQVME 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4T1NP_650910.1 PRK03996 5..239 CDD:235192 79/205 (39%)
proteasome_alpha_type_7 5..213 CDD:239724 79/205 (39%)
PAE1NP_001077717.1 proteasome_alpha_type_5 8..218 CDD:239722 79/205 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.