DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4T1 and PAF2

DIOPT Version :9

Sequence 1:NP_650910.1 Gene:Prosalpha4T1 / 42457 FlyBaseID:FBgn0265606 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_175158.1 Gene:PAF2 / 841128 AraportID:AT1G47250 Length:277 Species:Arabidopsis thaliana


Alignment Length:244 Identity:82/244 - (33%)
Similarity:137/244 - (56%) Gaps:10/244 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SRYGRALTIFSPDGHLLQVEYAQEAVRKGSTAVGVRGANCVVLGVEKSSVSEMQEDRTVRKISML 67
            ::|...:|.:||.|.|.|||||.|||::||.|:|:|..:.|||.....:.||:...:  |||..:
plant     4 NQYDTDVTTWSPTGRLFQVEYAMEAVKQGSAAIGLRSRSHVVLACVNKAQSELSSHQ--RKIFKV 66

  Fly    68 DRHVALAFAGLTADARILINRGQVECQSHRLNFENQVTLEYITRYLAQLKQKYTQCNGRRPFGIS 132
            |.|:.:|.||||||.|:|....:.|..:|...:|:.:.:..:..:||...|..||.:.:||:|:.
plant    67 DDHIGVAIAGLTADGRVLSRYMRSESINHSFTYESPLPVGRLVVHLADKAQVCTQRSWKRPYGVG 131

  Fly   133 CLIGGIDADGSARLFHTEPSGIFHEYKATATGRWANTVREFFEKAYSDHEVTTKCDAIKLAMRAL 197
            .|:||:|..| |.|::..|||.:.||:|.|.|..:...:.:.|:.:...:.::|.|.||.|:.|:
plant   132 LLVGGLDESG-AHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERKFESFQESSKEDLIKDAIMAI 195

  Fly   198 LEVTQMSQMR---LEVAVLENGKPMKMLDSVVISEIV----KIVQNEKE 239
            .|..|...::   ..|:||...:|...||...|.:::    |:.:.|::
plant   196 RETLQGETLKSSLCTVSVLGVDEPFHFLDQESIQKVIDTFEKVPEEEED 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4T1NP_650910.1 PRK03996 5..239 CDD:235192 82/240 (34%)
proteasome_alpha_type_7 5..213 CDD:239724 74/210 (35%)
PAF2NP_175158.1 proteasome_alpha_type_1 6..215 CDD:239718 75/211 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.