DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4T1 and PAD1

DIOPT Version :9

Sequence 1:NP_650910.1 Gene:Prosalpha4T1 / 42457 FlyBaseID:FBgn0265606 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_190694.1 Gene:PAD1 / 824289 AraportID:AT3G51260 Length:250 Species:Arabidopsis thaliana


Alignment Length:247 Identity:133/247 - (53%)
Similarity:170/247 - (68%) Gaps:7/247 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SRYGRALTIFSPDGHLLQVEYAQEAVRKGSTAVGVRGANCVVLGVEKSSVSEMQEDRTVRKISML 67
            :||.||:|:|||||||.|||||.||||||:.||||||.:.|||.|||.|..::|:.|:.|||..|
plant     2 ARYDRAITVFSPDGHLFQVEYALEAVRKGNAAVGVRGTDTVVLAVEKKSTPKLQDSRSARKIVSL 66

  Fly    68 DRHVALAFAGLTADARILINRGQVECQSHRLNFENQVTLEYITRYLAQLKQKYTQCNGRRPFGIS 132
            |.|:|||.|||.||||:|||:.::|||||||..|:.||:||||||:|.|:|||||..|.||||:|
plant    67 DNHIALACAGLKADARVLINKARIECQSHRLTLEDPVTVEYITRYIAGLQQKYTQSGGVRPFGLS 131

  Fly   133 CLIGGIDA-DGSARLFHTEPSGIFHEYKATATGRWANTVREFFEKAYSDHEVTTKCDAIKLAMRA 196
            .||.|.|. .....|:.|:|||.|..:||.||||.:|::|||.||.|.:   :...:.:|||:||
plant   132 TLIVGFDPYTRIPALYQTDPSGTFSAWKANATGRNSNSIREFLEKNYKE---SAGQETVKLAIRA 193

  Fly   197 LLEVTQMSQMRLEVAVL--ENGKPMKMLDSVVISEIVKIVQNEKELQAKAHK 246
            ||||.:.....:||||:  |.| .:|.|:...|..||..::.||.....|.|
plant   194 LLEVVESGGKNIEVAVMTREEG-VLKQLEEEEIDIIVAEIEAEKAAAEAAKK 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4T1NP_650910.1 PRK03996 5..239 CDD:235192 129/236 (55%)
proteasome_alpha_type_7 5..213 CDD:239724 120/208 (58%)
PAD1NP_190694.1 proteasome_alpha_type_7 4..210 CDD:239724 120/208 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 220 1.000 Domainoid score I721
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H2086
Inparanoid 1 1.050 270 1.000 Inparanoid score I920
OMA 1 1.010 - - QHG62217
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 1 1.000 - - FOG0002043
OrthoInspector 1 1.000 - - mtm1115
orthoMCL 1 0.900 - - OOG6_101207
Panther 1 1.100 - - O PTHR11599
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1345
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.