DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4T1 and AT3G26340

DIOPT Version :10

Sequence 1:NP_650910.1 Gene:Prosalpha4T1 / 42457 FlyBaseID:FBgn0265606 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_189265.1 Gene:AT3G26340 / 822238 AraportID:AT3G26340 Length:273 Species:Arabidopsis thaliana


Alignment Length:135 Identity:30/135 - (22%)
Similarity:62/135 - (45%) Gaps:12/135 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 AQEAVR--KGSTAVG-VRGANCVVLGVEKSSVSEMQEDRTVRKISMLDRHVALAFAGLTADARIL 85
            |.|.|:  ||:|.:. :.....:|....::|:......::|:||..::.::....||..||.:..
plant    48 AVEMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFW 112

  Fly    86 INRGQVECQSHRLNFENQVTLEYITRYLAQLKQKYTQCNGRRPFGIS--CLIGGIDADGSARLFH 148
            .....::|:.|.|..:.::::...::.||.:...|      |..|:|  .:|.|.|..|.. |::
plant   113 HRNLGIKCRLHELANKRRISVSGASKLLANMLYSY------RGMGLSVGTMIAGWDETGPG-LYY 170

  Fly   149 TEPSG 153
            .:..|
plant   171 VDNEG 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4T1NP_650910.1 proteasome_alpha_type_7 5..213 CDD:239724 30/135 (22%)
AT3G26340NP_189265.1 proteasome_beta_type_5 58..245 CDD:239730 25/125 (20%)

Return to query results.
Submit another query.